Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL_RS03550 [old locus tag: SACOL0690 ]
- pan locus tag?: SAUPAN002509000
- symbol: SACOL_RS03550
- pan gene symbol?: mntA
- synonym:
- product: phosphonate ABC transporter ATP-binding protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL_RS03550 [old locus tag: SACOL0690 ]
- symbol: SACOL_RS03550
- product: phosphonate ABC transporter ATP-binding protein
- replicon: chromosome
- strand: -
- coordinates: 714737..715480
- length: 744
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661
721TTGTTAGAAACAAAAGATTTAAATCTGTTTTTAGGTAATAAGCATGTACTTAAAAACATT
TCCTTATCGATACCAGTACGCGGCGAAATAATTGGTATCATGGGCCCGAATGGTGCTGGT
AAATCTTCCCTTATCAAGTCTTTAATTGGTGAATTTAATGCTACCGGTACTAAATTGTTA
TATAACAAACCTATACAACAACAACTGCAACATATTACATATATTCCACAAAAAGCACAT
ATTGATTTAGATTTTCCTATAAGTGTGGAACAAGTGATTTTATCAGGTTGCTACAAAGAA
ATTGGATGGTTTAGACGACCTAATAAATCAGCAAGGGATAAACTCAAACAGTTATTAAGC
GATTTAGAATTAGAATCTTTACGTCATCGACAAATTTCAGAATTAAGTGGTGGACAATTA
CAACGTGTGCTAGTAGCAAGAGCATTGATGTCCGAAAGTGAAGTTTATTTTCTAGATGAG
CCGTTTGTCGGAATTGATTTTAGTAGCGAAAAATTAATCATGACAAAAATCGAGAACTTA
AAACAACAAGGAAAACTTATTCTTATCATCCACCATGATCTATCAAAAGCAAAGCAATAC
TTTGATCGCATTATTCTATTAAATCAAACATTACGATACTTTGGTGATAGTGAAGAGGCT
ATGAGTGTCACTCGCTTAAACGAAACATTTATGAGTAGCACTGACTGTAGTGACCCTAGT
CAAAGGAGCAATATAACATGTTAG60
120
180
240
300
360
420
480
540
600
660
720
744
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL_RS03550 [old locus tag: SACOL0690 ]
- symbol: SACOL_RS03550
- description: phosphonate ABC transporter ATP-binding protein
- length: 247
- theoretical pI: 8.45919
- theoretical MW: 28024.2
- GRAVY: -0.217004
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 174)and 80 moreTransport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 110.4)Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 106.5)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 98.6)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 97.1)Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 97.1)Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 96.1)proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 95.6)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 94.6)Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 94.4)Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 94.4)thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 90.3)Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 86.9)Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 86.9)Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 86.8)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 86.3)Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 83.1)Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 83.1)Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 83.1)Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 82.9)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 81.4)thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 77.2)Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 76.8)Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 76.4)Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 74.6)gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 74.1)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 74)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 73.5)Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 73.4)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 73.4)Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 72.6)Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 72.2)phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 71.7)lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 71.1)Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 71)Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 70.1)Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 70.1)Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 70.1)Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 70)ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 67.9)D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 67)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 65.3)ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 63.9)Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 63.6)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 62.4)Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 62.4)2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 62.2)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 60.8)Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 60.1)Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 59.5)Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 59.5)ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 59.3)Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 59.2)Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 59.1)Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 58.8)Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 57.4)Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 56.9)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 56.9)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 56.9)Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 56.1)DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 55.4)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 53.6)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 53.6)ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 47.5)Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 45.4)Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 45.4)Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 40.8)Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 40.4)Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 39.3)Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 38.9)Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 32.6)Cellular processes Pathogenesis type II secretion system protein E (TIGR02533; HMM-score: 18.7)Protein fate Protein and peptide secretion and trafficking type II secretion system protein E (TIGR02533; HMM-score: 18.7)Transport and binding proteins Amino acids, peptides and amines LAO/AO transport system ATPase (TIGR00750; EC 2.7.-.-; HMM-score: 16.1)Regulatory functions Protein interactions LAO/AO transport system ATPase (TIGR00750; EC 2.7.-.-; HMM-score: 16.1)Purines, pyrimidines, nucleosides, and nucleotides Salvage of nucleosides and nucleotides uridine kinase (TIGR00235; EC 2.7.1.48; HMM-score: 15.9)Biosynthesis of cofactors, prosthetic groups, and carriers Molybdopterin molybdopterin-guanine dinucleotide biosynthesis protein B (TIGR00176; HMM-score: 14.8)Cellular processes Cell division chromosome segregation protein SMC (TIGR02168; HMM-score: 14)DNA metabolism Chromosome-associated proteins chromosome segregation protein SMC (TIGR02168; HMM-score: 14)Unknown function General small GTP-binding protein domain (TIGR00231; HMM-score: 12.1)nicotinamide-nucleotide adenylyltransferase (TIGR01526; EC 2.7.7.1; HMM-score: 11.7)
- TheSEED: see SACOL0690
- PFAM: P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 92.5)and 20 moreSMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 27.1)AAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 24)ATPase_2; ATPase domain predominantly from Archaea (PF01637; HMM-score: 20.2)RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 18.5)AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 18.3)MMR_HSR1; 50S ribosome-binding GTPase (PF01926; HMM-score: 17.5)AAA_22; AAA domain (PF13401; HMM-score: 17.5)AAA_16; AAA ATPase domain (PF13191; HMM-score: 15.8)RNA_helicase; RNA helicase (PF00910; HMM-score: 15.2)Dynamin_N; Dynamin family (PF00350; HMM-score: 14.7)ArgK; ArgK protein (PF03308; HMM-score: 14.6)AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 14.5)AAA_23; AAA domain (PF13476; HMM-score: 14.5)DUF815; Protein of unknown function (DUF815) (PF05673; HMM-score: 14.4)AAA_PrkA; PrkA AAA domain (PF08298; HMM-score: 13.8)MobB; Molybdopterin guanine dinucleotide synthesis protein B (PF03205; HMM-score: 13.7)AAA_35; AAA-like domain (PF14516; HMM-score: 13.2)AAA_14; AAA domain (PF13173; HMM-score: 13.1)KAP_NTPase; KAP family P-loop domain (PF07693; HMM-score: 12.9)AAA_26; AAA domain (PF13500; HMM-score: 12.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 1.05
- Cytoplasmic Membrane Score: 8.78
- Cellwall Score: 0.08
- Extracellular Score: 0.09
- Internal Helices: 0
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.011745
- TAT(Tat/SPI): 0.001085
- LIPO(Sec/SPII): 0.000968
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MLETKDLNLFLGNKHVLKNISLSIPVRGEIIGIMGPNGAGKSSLIKSLIGEFNATGTKLLYNKPIQQQLQHITYIPQKAHIDLDFPISVEQVILSGCYKEIGWFRRPNKSARDKLKQLLSDLELESLRHRQISELSGGQLQRVLVARALMSESEVYFLDEPFVGIDFSSEKLIMTKIENLKQQGKLILIIHHDLSKAKQYFDRIILLNQTLRYFGDSEEAMSVTRLNETFMSSTDCSDPSQRSNITC
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
SACOL_RS02145 acetyl-CoA acyltransferase [1] (data from MRSA252) SACOL_RS03755 LysR family transcriptional regulator [1] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: MntR* see SACOL0690
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.0 1.1 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)