Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL_RS03525 [old locus tag: SACOL0685 ]
- pan locus tag?: SAUPAN002500000
- symbol: SACOL_RS03525
- pan gene symbol?: mnhF2
- synonym: mrpF2
- product: cation:proton antiporter
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL_RS03525 [old locus tag: SACOL0685 ]
- symbol: SACOL_RS03525
- product: cation:proton antiporter
- replicon: chromosome
- strand: +
- coordinates: 708725..709027
- length: 303
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGATACAAACAATAACACATATTATGATTATTAGTTCACTCATTATTTTTGGAATTGCA
TTAATCATCTGTTTATTTAGATTAATCAAGGGACCTACAACAGCAGATCGTGTCGTTACA
TTTGATACAACAAGTGCTGTCGTAATGTCAATTGTGGGTGTGTTAAGTGTACTTATGGGC
ACCGTTTCTTTCTTAGATTCAATCATGCTCATTGCCATTATATCTTTTGTAAGTTCTGTT
TCAATATCACGCTTTATTGGTGGGGGGCATGTGTTTAATGGAAATAACAAAAGAAATCTT
TAG60
120
180
240
300
303
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL_RS03525 [old locus tag: SACOL0685 ]
- symbol: SACOL_RS03525
- description: cation:proton antiporter
- length: 100
- theoretical pI: 10.7502
- theoretical MW: 10729.9
- GRAVY: 1.2
⊟Function[edit | edit source]
- TIGRFAM: Cellular processes Toxin production and resistance circular bacteriocin, circularin A/uberolysin family (TIGR03651; HMM-score: 5.2)
- TheSEED: see SACOL0685
- PFAM: no clan defined MrpF_PhaF; Multiple resistance and pH regulation protein F (MrpF / PhaF) (PF04066; HMM-score: 48.2)and 1 moreFumRed-TM (CL0335) Fumarate_red_C; Fumarate reductase subunit C (PF02300; HMM-score: 12.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 3
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9994
- Cell wall & surface Score: 0
- Extracellular Score: 0.0006
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.019091
- TAT(Tat/SPI): 0.000307
- LIPO(Sec/SPII): 0.012594
- predicted transmembrane helices (TMHMM): 3
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MIQTITHIMIISSLIIFGIALIICLFRLIKGPTTADRVVTFDTTSAVVMSIVGVLSVLMGTVSFLDSIMLIAIISFVSSVSISRFIGGGHVFNGNNKRNL
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: SigB* see SACOL0685
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.