Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL_RS01625 [old locus tag: SACOL0322 ]
- pan locus tag?: SAUPAN001422000
- symbol: SACOL_RS01625
- pan gene symbol?: —
- synonym:
- product: transcriptional regulator
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL_RS01625 [old locus tag: SACOL0322 ]
- symbol: SACOL_RS01625
- product: transcriptional regulator
- replicon: chromosome
- strand: +
- coordinates: 358218..358436
- length: 219
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGCAATGGAATTTAATAAAGTTGAGAAAAGAAAGAAAGTGTACTCAAGAAGATTTAGCA
AACCTCTTGAATATATCAACTGAAGGTTATCGTTTAAAAGAATTAGGAAAGCATCAATTT
AAGAATGATGAGATGTTTATTATCGCTGATTTTTTTGACGAAAATATTGGAGATATTTTT
TTACCCACAAAGTACACGAAACGCAAACGAACATCTTAA60
120
180
219
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL_RS01625 [old locus tag: SACOL0322 ]
- symbol: SACOL_RS01625
- description: transcriptional regulator
- length: 72
- theoretical pI: 9.65905
- theoretical MW: 8682.97
- GRAVY: -0.797222
⊟Function[edit | edit source]
- TIGRFAM: Regulatory functions DNA interactions transcriptional regulator, y4mF family (TIGR03070; HMM-score: 17.6)
- TheSEED: data available for NCTC8325
- PFAM: HTH (CL0123) HTH_3; Helix-turn-helix (PF01381; HMM-score: 23.6)and 3 moreHTH_26; Cro/C1-type HTH DNA-binding domain (PF13443; HMM-score: 18.4)HTH_19; Helix-turn-helix domain (PF12844; HMM-score: 17.8)Sigma70_r4; Sigma-70, region 4 (PF04545; HMM-score: 16.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9442
- Cytoplasmic Membrane Score: 0.0058
- Cell wall & surface Score: 0.0075
- Extracellular Score: 0.0424
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002243
- TAT(Tat/SPI): 0.000162
- LIPO(Sec/SPII): 0.000522
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MQWNLIKLRKERKCTQEDLANLLNISTEGYRLKELGKHQFKNDEMFIIADFFDENIGDIFLPTKYTKRKRTS
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.