From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS01615 [old locus tag: SACOL0320 ]
  • pan locus tag?: SAUPAN001419000
  • symbol: SACOL_RS01615
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL_RS01615 [old locus tag: SACOL0320 ]
  • symbol: SACOL_RS01615
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 356975..357157
  • length: 183
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NC_002951 (356975..357157) NCBI
  • BioCyc: SACOL_RS01615 BioCyc
  • MicrobesOnline: see SACOL0320

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGAAAATAACTAATTGCAAAATAAAAAAAGAAACTATAGTATATGAAGTTTTAACTAGT
    GGTAATCAACCATTCACTTATGAGTTACCTAAAGATTTATCGTCACATAATGCGCGTAAA
    TACTTGGAATTTATTTCACAAAAAATAGATGGCGATAAGTTAACCAAAGAAGATTCATTA
    TGA
    60
    120
    180
    183

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL_RS01615 [old locus tag: SACOL0320 ]
  • symbol: SACOL_RS01615
  • description: hypothetical protein
  • length: 60
  • theoretical pI: 8.46415
  • theoretical MW: 6950.93
  • GRAVY: -0.695

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED: see SACOL0320
  • PFAM:
    PH (CL0266) DUF956; Domain of unknown function (DUF956) (PF06115; HMM-score: 12.3)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.8437
    • Cytoplasmic Membrane Score: 0.0145
    • Cell wall & surface Score: 0.0005
    • Extracellular Score: 0.1413
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.01744
    • TAT(Tat/SPI): 0.000262
    • LIPO(Sec/SPII): 0.007577
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MKITNCKIKKETIVYEVLTSGNQPFTYELPKDLSSHNARKYLEFISQKIDGDKLTKEDSL

Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

SACOL_RS01615 is similar to the fifth gene product of prophage ΦSA169 in Staphylococcus aureus SA169. Gp05 is a metabolic inhibitor that impairs the TCA cycle resulting in enhanced pigmentation, ppGpp alarmone synthesis and vancomycin tolerance.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]

[1]

  1. Yi Li, Fengli Zhu, Adhar C Manna, Liang Chen, Jason Jiang, Jong-In Hong, Richard A Proctor, Arnold S Bayer, Ambrose L Cheung, Yan Q Xiong
    Gp05, a Prophage-Encoded Virulence Factor, Contributes to Persistent Methicillin-Resistant Staphylococcus aureus Endovascular Infection.
    Microbiol Spectr: 2023, 11(4);e0060023
    [PubMed:37358448] [WorldCat.org] [DOI] (I p)