From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL2681 [new locus tag: SACOL_RS14035 ]
  • pan locus tag?: SAUPAN006403000
  • symbol: SACOL2681
  • pan gene symbol?: —
  • synonym:
  • product: hypothetical protein

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SACOL2681 [new locus tag: SACOL_RS14035 ]
  • symbol: SACOL2681
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 2757264..2757623
  • length: 360
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGATTTTGCGTTACGCAACGAATTTAAAACTTGCGAAAGAGCTATACCAAGCCAGTAAA
    CCTAAATTGCAAGAAGATAAGGGTATGATTGAACTGTTTGAACATACTTTTGGCTTGCAA
    AAAGAACTTGTAAAATACGTCGGCATTGCAGAAGCAACTACTGCTGCTTTATACTCAGCT
    AGCTTTATCAATAAAAACATTTCTCGCCTTGCATCACTATCAACGATAGGCATTTTAAGT
    GTAGCTGCTTACAAACATTTCGAAGCTGGCCAAGGTAAAAAAGGTGCACAACATGCATTA
    AATTTATTAGGTCTTGCTACTTTAAGTTTACTAGATACATTTTCTTGTAATAAAAAATAG
    60
    120
    180
    240
    300
    360


⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SACOL2681 [new locus tag: SACOL_RS14035 ]
  • symbol: SACOL2681
  • description: hypothetical protein
  • length: 119
  • theoretical pI: 10.0108
  • theoretical MW: 13021.1
  • GRAVY: 0.0369748

⊟Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • FIG01108094: hypothetical protein
  • PFAM:
    DoxD-like (CL0131) DoxX_2; DoxX-like family (PF13564; HMM-score: 22.8)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Extracellular
    • Cytoplasmic Score: 0.0128
    • Cytoplasmic Membrane Score: 0.2164
    • Cell wall & surface Score: 0.0245
    • Extracellular Score: 0.7463
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.00852
    • TAT(Tat/SPI): 0.00031
    • LIPO(Sec/SPII): 0.000307
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MILRYATNLKLAKELYQASKPKLQEDKGMIELFEHTFGLQKELVKYVGIAEATTAALYSASFINKNISRLASLSTIGILSVAAYKHFEAGQGKKGAQHALNLLGLATLSLLDTFSCNKK

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization: Cytoplasmic [1] [2]
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator: SigB* (activation) regulon
    SigB*(sigma factor)controlling a large regulon involved in stress/starvation response and adaptation;  [3] [4]   other strains

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  3. ↑ Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
    Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
    J Bacteriol: 2004, 186(13);4085-99
    [PubMed:15205410] [WorldCat.org] [DOI] (P p)
  4. ↑ Jan Pané-Farré, Beate Jonas, Konrad Förstner, Susanne Engelmann, Michael Hecker
    The sigmaB regulon in Staphylococcus aureus and its regulation.
    Int J Med Microbiol: 2006, 296(4-5);237-58
    [PubMed:16644280] [WorldCat.org] [DOI] (P p)

⊟Relevant publications[edit | edit source]