Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL2353 [new locus tag: SACOL_RS12360 ]
- pan locus tag?: SAUPAN005864000
- symbol: tcaR
- pan gene symbol?: tcaR
- synonym:
- product: transcriptional regulator TcaR
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL2353 [new locus tag: SACOL_RS12360 ]
- symbol: tcaR
- product: transcriptional regulator TcaR
- replicon: chromosome
- strand: -
- coordinates: 2412778..2413233
- length: 456
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3236068 NCBI
- RefSeq: YP_187159 NCBI
- BioCyc: see SACOL_RS12360
- MicrobesOnline: 913834 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGGTAAAACATTTACAAGACCATATTCAATTTTTAGAGCAGTTTATAAATAACGTTAAC
GCATTAACTGCAAAAATGTTGAAAGATTTACAAAATGAATATGAAATTTCATTAGAGCAG
TCTAACGTATTAGGTATGTTAAATAAAGAACCTTTGACAATTAGTGAAATCACGCAAAGA
CAAGGTGTAAATAAGGCCGCAGTAAGCCGACGAATTAAAAAGTTAATCGATGCTAAATTA
GTTAAGTTAGATAAACCAAATTTAAATATTGATCAACGTTTGAAATTCATAACCTTAACT
GACAAAGGTAGAGCATATTTGAAAGAACGTAATGCGATTATGACAGATATTGCGCAAGAT
ATTACTAATGATTTAAATTCTGAAGATATTGAAAATGTAAGGCAAGTATTAGAAGTCATC
AATCATCGCATTAAAACATATAGCAATCATAAATAG60
120
180
240
300
360
420
456
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL2353 [new locus tag: SACOL_RS12360 ]
- symbol: TcaR
- description: transcriptional regulator TcaR
- length: 151
- theoretical pI: 9.72614
- theoretical MW: 17521.1
- GRAVY: -0.525828
⊟Function[edit | edit source]
- TIGRFAM: homoprotocatechuate degradation operon regulator, HpaR (TIGR02337; HMM-score: 27.1)DNA metabolism DNA replication, recombination, and repair DnaD family protein (TIGR04548; HMM-score: 23)and 4 moremobile rSAM pair MarR family regulator (TIGR04472; HMM-score: 15.3)RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 14)Regulatory functions DNA interactions transcriptional regulator, Acidobacterial, PadR-family (TIGR03433; HMM-score: 14)Cellular processes Sporulation and germination stage II sporulation protein E (TIGR02865; EC 3.1.3.16; HMM-score: 7.9)
- TheSEED :
- Teicoplanin-resistance associated HTH-type transcriptional regulator TcaR
Regulation and Cell signaling Quorum sensing and biofilm formation Biofilm formation in Staphylococcus Teicoplanin-resistance associated HTH-type transcriptional regulator TcaRand 1 more - PFAM: HTH (CL0123) MarR_2; MarR family (PF12802; HMM-score: 39.1)and 19 moreHTH_20; Helix-turn-helix domain (PF12840; HMM-score: 28.2)HTH_27; Winged helix DNA-binding domain (PF13463; HMM-score: 27.9)HTH_5; Bacterial regulatory protein, arsR family (PF01022; HMM-score: 27)Staph_reg_Sar_Rot; Transcriptional regulator SarA/Rot (PF22381; HMM-score: 23.8)HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 23.1)MarR; MarR family (PF01047; HMM-score: 22.8)HTH_11; HTH domain (PF08279; HMM-score: 21.6)Rrf2; Iron-dependent Transcriptional regulator (PF02082; HMM-score: 20.1)TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 18.8)HTH_34; Winged helix DNA-binding domain (PF13601; HMM-score: 17.9)HTH_IclR; IclR helix-turn-helix domain (PF09339; HMM-score: 17.3)HemN_C; HemN C-terminal domain (PF06969; HMM-score: 16.2)no clan defined T4_Rnl2_C; T4 RNA ligase 2 C-terminal (PF18043; HMM-score: 15.6)HTH (CL0123) Sigma70_r4; Sigma-70, region 4 (PF04545; HMM-score: 15.4)UPF0122; Putative helix-turn-helix protein, YlxM / p13 like (PF04297; HMM-score: 15.2)Peptidase_CD (CL0093) Peptidase_C11; Clostripain family (PF03415; HMM-score: 14.9)HTH (CL0123) wHTH-PRTase_assc; wHTH-PRTase associated (PF24409; HMM-score: 12.7)HTH_Cmi2_C; Cmi2, C-terminal (PF24270; HMM-score: 12.2)C2H2-zf (CL0361) zf-CRD; Cysteine rich domain with multizinc binding regions (PF17979; HMM-score: 9.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9708
- Cytoplasmic Membrane Score: 0.0141
- Cell wall & surface Score: 0.0011
- Extracellular Score: 0.014
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002355
- TAT(Tat/SPI): 0.000213
- LIPO(Sec/SPII): 0.000279
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MVKHLQDHIQFLEQFINNVNALTAKMLKDLQNEYEISLEQSNVLGMLNKEPLTISEITQRQGVNKAAVSRRIKKLIDAKLVKLDKPNLNIDQRLKFITLTDKGRAYLKERNAIMTDIAQDITNDLNSEDIENVRQVLEVINHRIKTYSNHK
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1] [2]
- quantitative data / protein copy number per cell: 130 [3]
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e)
⊟Relevant publications[edit | edit source]
M Brandenberger, M Tschierske, P Giachino, A Wada, B Berger-Bächi
Inactivation of a novel three-cistronic operon tcaR-tcaA-tcaB increases teicoplanin resistance in Staphylococcus aureus.
Biochim Biophys Acta: 2000, 1523(2-3);135-9
[PubMed:11042376] [WorldCat.org] [DOI] (P p)