Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL2304 [new locus tag: SACOL_RS12120 ]
- pan locus tag?: SAUPAN005790000
- symbol: SACOL2304
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL2304 [new locus tag: SACOL_RS12120 ]
- symbol: SACOL2304
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 2366944..2367636
- length: 693
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3237360 NCBI
- RefSeq: YP_187111 NCBI
- BioCyc: see SACOL_RS12120
- MicrobesOnline: 913786 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661ATGAATAAAGCTGAAAGGCAAAATTTAATAATTACTGCAATTCAACAAAATAAAAAAATG
ACCGCTTTAGAATTAGCTAAATATTGCAACGTATCCAAACGCACAATTTTAAGAGATATT
GATGATTTAGAAAATCAAGGTGTTAAAATTTATGCGCATTATGGGAAAAATGGTGGTTAC
CAAATACAACAAGCACAATCTAAAATTGCATTAAACTTATCTGAAACACAATTATCAGCC
TTATTTTTAGTGCTTAATGAAAGTCAGTCGTACTCGACATTACCATATAAAAGCGAAATC
AACGCAATTATAAAACAATGTTTAAGTCTTCCACAAACACGCTTAAGAAAATTGCTTAAA
CGCATGGACTTTTATATTAAATTTGATGACACACAACATATGACACTCCCAATGCTGTTT
TCCGACATTTTAATTTATTGTACAGAACGAAATGTGATGTTAGTAGATCATAGGGTTGAT
GATAATATTAAAGCTGAAAACGTTATATTTATTGGCCTTTTGTGTAAACATGGACATTGG
CATGCAGTCATTTATGACATTGCTCAAGACAAAACTGCCGAACTCGAAATTGAAAATATT
ATAGATATTTCGTATTCATTCGGTAAGACGATTCAAACCAGAGACATATCCATTGATAAC
TATCATCAATTTTTAAACCCCATCGATTCCTAA60
120
180
240
300
360
420
480
540
600
660
693
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL2304 [new locus tag: SACOL_RS12120 ]
- symbol: SACOL2304
- description: hypothetical protein
- length: 230
- theoretical pI: 7.17682
- theoretical MW: 26618.5
- GRAVY: -0.268261
⊟Function[edit | edit source]
- TIGRFAM: Unknown function General Rrf2 family protein (TIGR00738; HMM-score: 17.7)DNA metabolism DNA replication, recombination, and repair DnaD family protein (TIGR04548; HMM-score: 16.8)Regulatory functions DNA interactions CRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 15.5)Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly SUF system regulator (TIGR02944; HMM-score: 15)Regulatory functions DNA interactions FeS assembly SUF system regulator (TIGR02944; HMM-score: 15)and 4 moreUnknown function General DNA binding domain, excisionase family (TIGR01764; HMM-score: 14)Biosynthesis of cofactors, prosthetic groups, and carriers Other iron-sulfur cluster biosynthesis transcriptional regulator SufR (TIGR02702; HMM-score: 13)Regulatory functions DNA interactions iron-sulfur cluster biosynthesis transcriptional regulator SufR (TIGR02702; HMM-score: 13)Regulatory functions DNA interactions biotin operon repressor (TIGR00122; HMM-score: 12.1)
- TheSEED :
- Transcriptional regulator, DeoR family
- PFAM: HTH (CL0123) HTH_11; HTH domain (PF08279; HMM-score: 48.3)and 14 moreHTH_DeoR; DeoR-like helix-turn-helix domain (PF08220; HMM-score: 36.9)Rrf2; Iron-dependent Transcriptional regulator (PF02082; HMM-score: 23.3)HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 21.8)HTH_Mga; M protein trans-acting positive regulator (MGA) HTH domain (PF08280; HMM-score: 18.4)HTH_36; Helix-turn-helix domain (PF13730; HMM-score: 16.8)Tn7_Tnp_TnsA_C; TnsA endonuclease C terminal (PF08721; HMM-score: 15.1)no clan defined Dicer_PBD; Dicer, partner-binding domain (PF20930; HMM-score: 14.1)HTH (CL0123) MarR; MarR family (PF01047; HMM-score: 13.7)TBPIP; TBPIP/Hop2 winged helix domain (PF07106; HMM-score: 13.6)HTH_27; Winged helix DNA-binding domain (PF13463; HMM-score: 13.6)HTH_AsnC-type; AsnC-type helix-turn-helix domain (PF13404; HMM-score: 12.8)HTH_Crp_2; Crp-like helix-turn-helix domain (PF13545; HMM-score: 12.5)HTH_PafC; PafC helix-turn-helix domain (PF19187; HMM-score: 12.1)TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 11.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.8786
- Cytoplasmic Membrane Score: 0.0728
- Cell wall & surface Score: 0.0021
- Extracellular Score: 0.0465
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.017591
- TAT(Tat/SPI): 0.000918
- LIPO(Sec/SPII): 0.002332
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MNKAERQNLIITAIQQNKKMTALELAKYCNVSKRTILRDIDDLENQGVKIYAHYGKNGGYQIQQAQSKIALNLSETQLSALFLVLNESQSYSTLPYKSEINAIIKQCLSLPQTRLRKLLKRMDFYIKFDDTQHMTLPMLFSDILIYCTERNVMLVDHRVDDNIKAENVIFIGLLCKHGHWHAVIYDIAQDKTAELEIENIIDISYSFGKTIQTRDISIDNYHQFLNPIDS
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1] [2] [3]
- quantitative data / protein copy number per cell: 143 [4]
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator: CcpA regulon
CcpA (TF) important in Carbon catabolism; RegPrecise
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: 51.2 h [5]
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e) - ↑ Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
Mol Cell Proteomics: 2012, 11(9);558-70
[PubMed:22556279] [WorldCat.org] [DOI] (I p)