Jump to navigation
Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL2012 [new locus tag: SACOL_RS10505 ]
- pan locus tag?: SAUPAN005239000
- symbol: SACOL2012
- pan gene symbol?: —
- synonym:
- product: acetyltransferase
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL2012 [new locus tag: SACOL_RS10505 ]
- symbol: SACOL2012
- product: acetyltransferase
- replicon: chromosome
- strand: -
- coordinates: 2073219..2073662
- length: 444
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3238122 NCBI
- RefSeq: YP_186832 NCBI
- BioCyc: see SACOL_RS10505
- MicrobesOnline: 913487 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGAGCATAATTACAAGATTGTTTAATAACAGTGATTTTGAAAAATTAAATCAACTATGT
AAATTATATGATGATCTAGGTTATCCAACAAATGAGAATGATTTAAAAAAGAGACTAAAG
AAAATAACGAATCATGATGATTACTTCCTACTGCTTTTGATAAAAGAAAATAAAATAATT
GGTTTAAGTGGTATGTGTAAAATGATGTTTTACGAAAAAAATGCAGAGTATATGAGAATC
CTTGCGTTTGTTATACATTCTGAATTTAGGAAAAAAGGTTATGGAAAGAGATTATTAGCT
GATTCTGAAGAATTTTCTAAACGGTTGAATTGTAAAGCAATAACACTAAATAGTGGTAAT
AGAAATGAAAGACTATCTGCACATAAACTATATAGTGATAATGGGTATGTTAGCAATACA
TCTGGGTTTACTAAACAACTATAA60
120
180
240
300
360
420
444
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL2012 [new locus tag: SACOL_RS10505 ]
- symbol: SACOL2012
- description: acetyltransferase
- length: 147
- theoretical pI: 9.79636
- theoretical MW: 17195.8
- GRAVY: -0.559864
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Ribosomal proteins: synthesis and modification ribosomal-protein-alanine acetyltransferase (TIGR01575; EC 2.3.1.128; HMM-score: 33.6)and 4 moreputative beta-lysine N-acetyltransferase (TIGR03827; EC 2.3.1.-; HMM-score: 18.8)Cell envelope Biosynthesis and degradation of murein sacculus and peptidoglycan N-acetylmuramoyl-L-alanine amidase CwlD (TIGR02883; EC 3.5.1.28; HMM-score: 13.1)Cellular processes Sporulation and germination N-acetylmuramoyl-L-alanine amidase CwlD (TIGR02883; EC 3.5.1.28; HMM-score: 13.1)Transcription DNA-dependent RNA polymerase radical SAM enzyme/protein acetyltransferase, ELP3 family (TIGR01211; EC 2.3.1.48; HMM-score: 12.2)
- TheSEED :
- Acetyltransferase, GNAT family
- PFAM: Acetyltrans (CL0257) Acetyltransf_1; Acetyltransferase (GNAT) family (PF00583; HMM-score: 44.3)Acetyltransf_7; Acetyltransferase (GNAT) domain (PF13508; HMM-score: 37.5)and 3 moreAcetyltransf_10; Acetyltransferase (GNAT) domain (PF13673; HMM-score: 27.6)Acetyltransf_3; Acetyltransferase (GNAT) domain (PF13302; HMM-score: 18.7)Acetyltransf_15; Putative acetyl-transferase (PF17013; HMM-score: 17.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9521
- Cytoplasmic Membrane Score: 0.001
- Cell wall & surface Score: 0
- Extracellular Score: 0.0469
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.006037
- TAT(Tat/SPI): 0.000144
- LIPO(Sec/SPII): 0.000754
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSIITRLFNNSDFEKLNQLCKLYDDLGYPTNENDLKKRLKKITNHDDYFLLLLIKENKIIGLSGMCKMMFYEKNAEYMRILAFVIHSEFRKKGYGKRLLADSEEFSKRLNCKAITLNSGNRNERLSAHKLYSDNGYVSNTSGFTKQL
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1] [2] [3]
- quantitative data / protein copy number per cell: 72 [4]
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e) - ↑ Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
J Bacteriol: 2004, 186(13);4085-99
[PubMed:15205410] [WorldCat.org] [DOI] (P p)