Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL1999 [new locus tag: SACOL_RS10445 ]
- pan locus tag?: SAUPAN005003000
- symbol: SACOL1999
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL1999 [new locus tag: SACOL_RS10445 ]
- symbol: SACOL1999
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2059374..2059472
- length: 99
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3238152 NCBI
- RefSeq: YP_186823 NCBI
- BioCyc: see SACOL_RS10445
- MicrobesOnline: 913477 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61ATGATGTGGTGGCAAGAAGGGATGATGACACTTATTACAGGTGGCTTACTAATTATTTTT
CGACTTTGGTTAGAACTGAAATGGAAAAATAAAAAATGA60
99
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL1999 [new locus tag: SACOL_RS10445 ]
- symbol: SACOL1999
- description: hypothetical protein
- length: 32
- theoretical pI: 10.7943
- theoretical MW: 3995.95
- GRAVY: 0.2
⊟Function[edit | edit source]
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 1.04
- Cytoplasmic Membrane Score: 6.46
- Cellwall Score: 1.3
- Extracellular Score: 1.2
- Internal Helix: 1
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9993
- Cell wall & surface Score: 0
- Extracellular Score: 0.0007
- LocateP: N-terminally anchored (No CS)
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -1
- N-terminally Anchored Score: 2
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.044195
- TAT(Tat/SPI): 0.002706
- LIPO(Sec/SPII): 0.033345
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MMWWQEGMMTLITGGLLIIFRLWLELKWKNKK
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- data available for JSNZ
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here.