Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL1934 [new locus tag: SACOL_RS10115 ]
- pan locus tag?: SAUPAN004861000
- symbol: SACOL1934
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL1934 [new locus tag: SACOL_RS10115 ]
- symbol: SACOL1934
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1998562..1998723
- length: 162
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3237520 NCBI
- RefSeq: YP_186759 NCBI
- BioCyc: see SACOL_RS10115
- MicrobesOnline: 913413 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121ATGAATGAACAGCAAACAATCGAACAGATAAAAGCGCGTTTAAATAAGTTTATTGAGGAT
ATCGATCATGTAAATCCTGATGAAGTACGTGTTGAAGATATAGATGAATGGATTGGATTG
TTAGATCAGCTTGAAGAAAAGGTTAAATTAGTATCTAAGTAA60
120
162
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL1934 [new locus tag: SACOL_RS10115 ]
- symbol: SACOL1934
- description: hypothetical protein
- length: 53
- theoretical pI: 4.16778
- theoretical MW: 6305.07
- GRAVY: -0.681132
⊟Function[edit | edit source]
- TIGRFAM: Regulatory functions DNA interactions CRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 12.8)Energy metabolism Other tetrahydromethanopterin S-methyltransferase, subunit G (TIGR01149; EC 2.1.1.86; HMM-score: 11.6)
- TheSEED :
- Uncharacterized protein YfjT
- PFAM: Spectrin (CL0743) Spectrin_Anc-1_2; Nuclear anchorage protein 1, spectrin repeat (PF24615; HMM-score: 16.5)and 2 moreno clan defined SERRATE_Ars2_N; SERRATE/Ars2, N-terminal domain (PF12066; HMM-score: 12.9)MtrG; Tetrahydromethanopterin S-methyltransferase, subunit G (PF04210; HMM-score: 11.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.8348
- Cytoplasmic Membrane Score: 0.0082
- Cell wall & surface Score: 0.001
- Extracellular Score: 0.156
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.005243
- TAT(Tat/SPI): 0.00063
- LIPO(Sec/SPII): 0.00055
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MNEQQTIEQIKARLNKFIEDIDHVNPDEVRVEDIDEWIGLLDQLEEKVKLVSK
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization:
- quantitative data / protein copy number per cell: 609 [1]
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e)