From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1784 [new locus tag: SACOL_RS09135 ]
  • pan locus tag?: SAUPAN004398000
  • symbol: acuA
  • pan gene symbol?: acuA
  • synonym:
  • product: acetoin utilization protein AcuA

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL1784 [new locus tag: SACOL_RS09135 ]
  • symbol: acuA
  • product: acetoin utilization protein AcuA
  • replicon: chromosome
  • strand: +
  • coordinates: 1828381..1829013
  • length: 633
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGAATCATTTAAAGACGTATCAATCCGAAGATTATTACATTCATGACAAGCAATTTGTT
    ATTGAAGGTCCTTTAACACACGAAGATTTGAAAGCGCTTACTTTCGATGCGCATTTAACC
    GCATTTAGAGATGCTGAAGATCAGTATAAAGCTTTGTTAGAAATTACAACATTACCAGAA
    GGTAGAATTTATGTTGCTCGCCAAGATCAACTCATTGTGGGTTATGTCACTTTCCACTAT
    CCTGATGAAATTGAGCGCTGGTCTACAGGTAAGCTTCCATATTTAATCGAATTGGGGGCA
    ATTGAAGTCAGCATCAATTTTAGGCAATTACAACTTGCAGAAAAGCTGATACAACTTAGC
    CTTTCTACACCAGAATTCGAGAATTATATCGTTATAACTACAGAATATTACTGGCATTGG
    GATTTAAAAAATTCAAAGTTAGATGTATTTGACTATAAAAAATTAATGCAGCGGTTAATG
    GCAACTGGTGGACTTGAAATATTCGCTACAGATGATCCAGAAATAACAAGTCATCCAGCT
    AATTGTTTAATGGCAAGAATTGGCAAAAACATTACATTAGAACAGCAACAAGCGTTTGAT
    GATATTCGTTATATGAATCGGTTTTTCTTTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    633

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL1784 [new locus tag: SACOL_RS09135 ]
  • symbol: AcuA
  • description: acetoin utilization protein AcuA
  • length: 210
  • theoretical pI: 4.741
  • theoretical MW: 24776
  • GRAVY: -0.325238

Function[edit | edit source]

  • reaction:
    EC 2.3.1.-?  ExPASy
  • TIGRFAM:
  • TheSEED  :
    • Acetyltransferase AcuA, acetyl-CoA synthetase inhibitor
    Carbohydrates Central carbohydrate metabolism Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate  Acetyltransferase AcuA, acetyl-CoA synthetase inhibitor
  • PFAM:
    Acetyltrans (CL0257) Acetyltransf_1; Acetyltransferase (GNAT) family (PF00583; HMM-score: 19.6)
    and 1 more
    Acetyltransf_7; Acetyltransferase (GNAT) domain (PF13508; HMM-score: 14.4)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9741
    • Cytoplasmic Membrane Score: 0.0011
    • Cell wall & surface Score: 0.0002
    • Extracellular Score: 0.0246
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.001896
    • TAT(Tat/SPI): 0.000419
    • LIPO(Sec/SPII): 0.000233
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MNHLKTYQSEDYYIHDKQFVIEGPLTHEDLKALTFDAHLTAFRDAEDQYKALLEITTLPEGRIYVARQDQLIVGYVTFHYPDEIERWSTGKLPYLIELGAIEVSINFRQLQLAEKLIQLSLSTPEFENYIVITTEYYWHWDLKNSKLDVFDYKKLMQRLMATGGLEIFATDDPEITSHPANCLMARIGKNITLEQQQAFDDIRYMNRFFF

Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Cytoplasmic [1] [2]
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulators: CcpA regulon, CodY (repression) regulon
    CcpA(TF)important in Carbon catabolism; RegPrecise 
    CodY(TF)important in Amino acid metabolism; RegPrecise 

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]