Jump to navigation
Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL1529 [new locus tag: SACOL_RS07795 ]
- pan locus tag?: SAUPAN003958000
- symbol: SACOL1529
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL1529 [new locus tag: SACOL_RS07795 ]
- symbol: SACOL1529
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1566821..1567027
- length: 207
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3237603 NCBI
- RefSeq: YP_186371 NCBI
- BioCyc: see SACOL_RS07795
- MicrobesOnline: 912979 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGAATAAAATAAATGATAGAGATTTAACAGAATTGAGTAGCTATAGGGTTTATCAAGAC
ATCAATAAAGATAATGACTTTACAGTTAACGAAAAACGATTTAAGCAGGCAGATGTATTT
GAAGATTTATATAGAGAGAAACTAAAAGACACAAATAAATTAAGAGAGTATAATTATTTA
CAAAATGAAACTTTTAAAAGCGCATAA60
120
180
207
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL1529 [new locus tag: SACOL_RS07795 ]
- symbol: SACOL1529
- description: hypothetical protein
- length: 68
- theoretical pI: 5.12305
- theoretical MW: 8363.17
- GRAVY: -1.35
⊟Function[edit | edit source]
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0.2752
- Cytoplasmic Membrane Score: 0.0013
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.7235
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.008291
- TAT(Tat/SPI): 0.000889
- LIPO(Sec/SPII): 0.002347
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MNKINDRDLTELSSYRVYQDINKDNDFTVNEKRFKQADVFEDLYREKLKDTNKLREYNYLQNETFKSA
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.