Jump to navigation
		Jump to search
		
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL1191 [new locus tag: SACOL_RS06100 ]
- pan locus tag?: SAUPAN003448000
- symbol: mraZ
- pan gene symbol?: mraZ
- synonym:
- product: cell division protein MraZ
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL1191 [new locus tag: SACOL_RS06100 ]
- symbol: mraZ
- product: cell division protein MraZ
- replicon: chromosome
- strand: +
- coordinates: 1195862..1196293
- length: 432
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3238641 NCBI
- RefSeq: YP_186054 NCBI
- BioCyc: see SACOL_RS06100
- MicrobesOnline: 912659 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
 61
 121
 181
 241
 301
 361
 421ATGTTCATGGGAGAATACGATCATCAATTAGATACAAAAGGACGTATGATTATACCGTCC
 AAGTTTCGTTATGACTTAAATGAGCGTTTTATTATCACAAGAGGCCTTGATAAATGTTTA
 TTCGGTTACACTCTAGACGAATGGCAACAGATTGAAGAGAAAATGAAAACCTTACCTATG
 ACAAAAAAAGACGCACGTAAGTTTATGCGTATGTTCTTCTCTGGTGCTGTTGAAGTAGAA
 CTTGATAAGCAAGGGCGTATTAACATCCCTCAAAACTTGAGGAAATACGCTAATTTAACT
 AAAGAATGTACAGTAATCGGTGTTTCAAATCGTATTGAGATTTGGGATAGAGAAACTTGG
 AATGATTTCTATGAAGAATCTGAAGAAAGTTTCGAAGATATTGCTGAAGATTTAATAGAT
 TTTGATTTTTAA60
 120
 180
 240
 300
 360
 420
 432
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL1191 [new locus tag: SACOL_RS06100 ]
- symbol: MraZ
- description: cell division protein MraZ
- length: 143
- theoretical pI: 4.52156
- theoretical MW: 17237.5
- GRAVY: -0.646154
⊟Function[edit | edit source]
- TIGRFAM: Cellular processes Cell division division/cell wall cluster transcriptional repressor MraZ (TIGR00242; HMM-score: 185.8)Regulatory functions DNA interactions division/cell wall cluster transcriptional repressor MraZ (TIGR00242; HMM-score: 185.8)and 2 moreRegulatory functions DNA interactions transcriptional regulator, AbrB family (TIGR01439; HMM-score: 22.8)Hypothetical proteins Conserved TIGR02922 family protein (TIGR02922; HMM-score: 14.1)
- TheSEED  : - Cell division protein MraZ
 
- PFAM: AbrB (CL0132) MraZ; MraZ protein, putative antitoxin-like (PF02381; HMM-score: 175)and 1 moreno clan defined DUF2375; Protein of unknown function (DUF2375) (PF09558; HMM-score: 13.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
 
- DeepLocPro: Cytoplasmic- Cytoplasmic Score: 0.9878
- Cytoplasmic Membrane Score: 0.0045
- Cell wall & surface Score: 0
- Extracellular Score: 0.0077
 
- LocateP: Intracellular - Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
 
- SignalP: no predicted signal peptide- SP(Sec/SPI): 0.002774
- TAT(Tat/SPI): 0.000201
- LIPO(Sec/SPII): 0.000651
 
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MFMGEYDHQLDTKGRMIIPSKFRYDLNERFIITRGLDKCLFGYTLDEWQQIEEKMKTLPMTKKDARKFMRMFFSGAVEVELDKQGRINIPQNLRKYANLTKECTVIGVSNRIEIWDRETWNDFYEESEESFEDIAEDLIDFDF
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: mraZ > mraW > SACOL1193 > pbp1
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker  
 A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
 PLoS One: 2009, 4(12);e8176
 [PubMed:19997597] [WorldCat.org] [DOI] (I e)
- ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher  
 The Staphylococcus aureus proteome.
 Int J Med Microbiol: 2014, 304(2);110-20
 [PubMed:24439828] [WorldCat.org] [DOI] (I p)
- ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker  
 Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
 Sci Rep: 2016, 6;28172
 [PubMed:27344979] [WorldCat.org] [DOI] (I e)
