From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1151 [new locus tag: SACOL_RS05880 ]
  • pan locus tag?: SAUPAN003379000
  • symbol: SACOL1151
  • pan gene symbol?: zapA
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL1151 [new locus tag: SACOL_RS05880 ]
  • symbol: SACOL1151
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1160484..1160750
  • length: 267
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGACACAGTTTAAAAACAAGGTAAATGTATCAATTAATGATCAGCTTTTTACAATTGTT
    GGGGAAGATAACCCAGAGCACATACGATATGTAGCACATTTAGTTGATGATAAAATAAAA
    GAATTAGGGTATAAAGCAGCAGGTTTAGATACTTCAAGAAAAGCAATACTAACTGCTGTG
    AATATTATGCATGAAAAAGTACTACTAGAAGAAGAAAATCGACGTTTGAAACAACAAATT
    CACAAATTGCAGCAGCGTGAGCAATAA
    60
    120
    180
    240
    267

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL1151 [new locus tag: SACOL_RS05880 ]
  • symbol: SACOL1151
  • description: hypothetical protein
  • length: 88
  • theoretical pI: 9.00732
  • theoretical MW: 10280.7
  • GRAVY: -0.655682

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Central intermediary metabolism Other methionine adenosyltransferase (TIGR01034; EC 2.5.1.6; HMM-score: 13.5)
  • TheSEED  :
    • Z-ring-associated protein
  • PFAM:
    no clan defined ZapA; Cell division protein ZapA (PF05164; HMM-score: 60.5)
    and 2 more
    YicC-like_C; Endoribonuclease YicC-like, C-terminal (PF08340; HMM-score: 16.1)
    S-AdoMet_synt_N; S-adenosylmethionine synthetase, N-terminal domain (PF00438; HMM-score: 14.1)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9914
    • Cytoplasmic Membrane Score: 0.0013
    • Cell wall & surface Score: 0.0004
    • Extracellular Score: 0.0069
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.002669
    • TAT(Tat/SPI): 0.000109
    • LIPO(Sec/SPII): 0.000402
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MTQFKNKVNVSINDQLFTIVGEDNPEHIRYVAHLVDDKIKELGYKAAGLDTSRKAILTAVNIMHEKVLLEEENRRLKQQIHKLQQREQ

Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Cytoplasmic [1]
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]