Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL0937 [new locus tag: SACOL_RS04805 ]
- pan locus tag?: SAUPAN003033000
- symbol: dltC
- pan gene symbol?: dltC
- synonym:
- product: D-alanine--poly(phosphoribitol) ligase subunit 2
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL0937 [new locus tag: SACOL_RS04805 ]
- symbol: dltC
- product: D-alanine--poly(phosphoribitol) ligase subunit 2
- replicon: chromosome
- strand: +
- coordinates: 940572..940808
- length: 237
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3237729 NCBI
- RefSeq: YP_185807 NCBI
- BioCyc: see SACOL_RS04805
- MicrobesOnline: 912407 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGGAATTTAGAGAACAAGTATTAAATTTATTAGCAGAAGTAGCAGAAAATGATATTGTA
AAAGAAAATCCAGACGTAGAAATTTTTGAAGAAGGTATTATTGATTCTTTCCAAACAGTT
GGATTATTATTAGAGATTCAAAATAAACTTGATATCGAAGTATCTATTATGGACTTTGAT
AGAGATGAGTGGGCAACACCAAATAAAATCGTTGAAGCATTAGAAGAGTTACGATGA60
120
180
237
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL0937 [new locus tag: SACOL_RS04805 ]
- symbol: DltC
- description: D-alanine--poly(phosphoribitol) ligase subunit 2
- length: 78
- theoretical pI: 3.67678
- theoretical MW: 9063.14
- GRAVY: -0.164103
⊟Function[edit | edit source]
- reaction: EC 6.1.1.13? ExPASyD-alanine--poly(phosphoribitol) ligase ATP + D-alanine + poly(ribitol phosphate) = AMP + diphosphate + O-D-alanyl-poly(ribitol phosphate)
- TIGRFAM: Cell envelope Biosynthesis and degradation of murein sacculus and peptidoglycan D-alanine--poly(phosphoribitol) ligase, subunit 2 (TIGR01688; EC 6.1.1.13; HMM-score: 136.3)and 1 moreFatty acid and phospholipid metabolism Biosynthesis acyl carrier protein (TIGR00517; HMM-score: 13.5)
- TheSEED :
- D-alanyl-carrier protein DltC
Cell Wall and Capsule Gram-Positive cell wall components D-Alanyl Lipoteichoic Acid Biosynthesis D-alanine--poly(phosphoribitol) ligase subunit 2 (EC 6.1.1.13)and 1 more - PFAM: PP-binding (CL0314) PP-binding; Phosphopantetheine attachment site (PF00550; HMM-score: 31.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9959
- Cytoplasmic Membrane Score: 0.0017
- Cell wall & surface Score: 0
- Extracellular Score: 0.0024
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002447
- TAT(Tat/SPI): 0.000177
- LIPO(Sec/SPII): 0.000198
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MEFREQVLNLLAEVAENDIVKENPDVEIFEEGIIDSFQTVGLLLEIQNKLDIEVSIMDFDRDEWATPNKIVEALEELR
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1] [2]
- quantitative data / protein copy number per cell: 2954 [3]
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: 22.9 h [4]
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e) - ↑ Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
Mol Cell Proteomics: 2012, 11(9);558-70
[PubMed:22556279] [WorldCat.org] [DOI] (I p)