Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL0678 [new locus tag: SACOL_RS03495 ]
- pan locus tag?: SAUPAN002492000
- symbol: SACOL0678
- pan gene symbol?: —
- synonym:
- product: phage integrase integrase/recombinase
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL0678 [new locus tag: SACOL_RS03495 ]
- symbol: SACOL0678
- product: phage integrase integrase/recombinase
- replicon: chromosome
- strand: +
- coordinates: 703025..703585
- length: 561
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3238465 NCBI
- RefSeq: YP_185561 NCBI
- BioCyc: see SACOL_RS03495
- MicrobesOnline: 912157 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541ATGAATAAAGTAGAAGCGATTAAATTTAATGATGATATTGTTAAAATGTATGAAGCGCTC
AAGATAAAATCTGAACGTGACTATTTATTCTTTAAGTTAGCTATACATAGTGGATTGAAA
GTATCAGAATTATTAACAATTACAGTCTCTCAAGTTAAGAGACTAATTGAAAAGTGTACG
TTATCAGAAATGTGTAAAGCACATTTTCATTCGTTGATTAAAATTAGGTTACCAGAAACA
TTATCGAAAGAACTACTTCAATATATAGAGGACAGGAGTCTTTCGAATGAAGACGTTCTT
TTTCAATCACTACGAACAAATCAAGTATTATCTAGACAGCAAGCATATCGAATAATTCAC
CAAGCATCAATTGAAGCTGGTATAGATAATGTAGGACTAACGACATTGCGTAAGACATTT
GCATATCATGCTTATCAAAAAGGTATACCTATACCAGTCATTCAAAAGTATTTAGGGCAT
CAATCTGCTATTGAAACACTAAATTTTATCGGTTTAGAAAATGAGTGTGAACATAGTATT
TATATTTCATTACAATTATAG60
120
180
240
300
360
420
480
540
561
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL0678 [new locus tag: SACOL_RS03495 ]
- symbol: SACOL0678
- description: phage integrase integrase/recombinase
- length: 186
- theoretical pI: 8.45255
- theoretical MW: 21455.8
- GRAVY: -0.104839
⊟Function[edit | edit source]
- TIGRFAM: DNA metabolism DNA replication, recombination, and repair tyrosine recombinase XerD (TIGR02225; HMM-score: 63.6)and 3 moreDNA metabolism DNA replication, recombination, and repair tyrosine recombinase XerC (TIGR02224; HMM-score: 39.3)DNA metabolism DNA replication, recombination, and repair integron integrase (TIGR02249; HMM-score: 30.7)Mobile and extrachromosomal element functions Other integron integrase (TIGR02249; HMM-score: 30.7)
- TheSEED :
- DNA integration/recombination/inversion protein
- PFAM: DNA-mend (CL0382) Phage_integrase; Phage integrase family (PF00589; HMM-score: 79.9)and 2 morePhage_integr_3; Archaeal phage integrase (PF16795; HMM-score: 20.9)no clan defined ADSL_C; Adenylosuccinate lyase C-terminus (PF10397; HMM-score: 13.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.8207
- Cytoplasmic Membrane Score: 0.1273
- Cell wall & surface Score: 0.003
- Extracellular Score: 0.049
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.005027
- TAT(Tat/SPI): 0.00212
- LIPO(Sec/SPII): 0.00081
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MNKVEAIKFNDDIVKMYEALKIKSERDYLFFKLAIHSGLKVSELLTITVSQVKRLIEKCTLSEMCKAHFHSLIKIRLPETLSKELLQYIEDRSLSNEDVLFQSLRTNQVLSRQQAYRIIHQASIEAGIDNVGLTTLRKTFAYHAYQKGIPIPVIQKYLGHQSAIETLNFIGLENECEHSIYISLQL
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1] [2] [3]
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: SigB* (activation) regulon
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
J Bacteriol: 2004, 186(13);4085-99
[PubMed:15205410] [WorldCat.org] [DOI] (P p) - ↑ Jan Pané-Farré, Beate Jonas, Konrad Förstner, Susanne Engelmann, Michael Hecker
The sigmaB regulon in Staphylococcus aureus and its regulation.
Int J Med Microbiol: 2006, 296(4-5);237-58
[PubMed:16644280] [WorldCat.org] [DOI] (P p)