From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0444 [new locus tag: SACOL_RS02240 ]
  • pan locus tag?: SAUPAN001971000
  • symbol: SACOL0444
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL0444 [new locus tag: SACOL_RS02240 ]
  • symbol: SACOL0444
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 447487..448059
  • length: 573
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    ATGAAATTAAAATCATTAGCAGTGTTATCAATGTCAGCGGTGGTGCTTACTGCATGTGGC
    AATGATACTCCAAAAGATGAAACAAAATCAACAGAGTCAAATACTAATCAAGACACTAAT
    ACAACAAAAGATGTTATTGCTTTAAAAGATGTTAAAACAAGCCCAGAAGATGCTGTGAAA
    AAAGCTGAAGAAACTTACAAAGGCCAAAAGTTGAAAGGAATTTCATTTGAAAATTCTAAT
    GGTGAATGGGCTTATAAAGTGACGCAACAAAAATCTGGTGAAGAGTCAGAAGTACTTGTT
    GCTGATAAAAATAAAAAAGTGATTAACAAAAAGACTGAAAAAGAAGATACAATGAATGAA
    AATGATAACTTTAAATATAGCGATGCTATAGATTACAAAAAAGCCATTAAAGAAGGACAA
    AAAGAATTTGATGGTGATATTAAAGAATGGTCACTTGAAAAAGATGATGGCAAACTTGTT
    TACAATATCGATTTGAAAAAAGGTAATAAAAAACAAGAAGTTACTGTTGATGCTAAGAAC
    GGTAAAGTATTAAAGAGTGAGCAAGATCACTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    573

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL0444 [new locus tag: SACOL_RS02240 ]
  • symbol: SACOL0444
  • description: hypothetical protein
  • length: 190
  • theoretical pI: 5.53203
  • theoretical MW: 21305.6
  • GRAVY: -1.10474

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • FIG01108790: hypothetical protein
  • PFAM:
    PepSY (CL0320) PepSY; Peptidase propeptide and YPEB domain (PF03413; HMM-score: 69.2)
    and 3 more
    PepSY_2; Peptidase propeptide and YPEB domain (PF13670; HMM-score: 17.8)
    TBP-like (CL0407) PGM1_C_vert_fung; Phosphoglucomutase-1, C-terminal domain (PF24947; HMM-score: 12)
    no clan defined NusG_II; NusG domain II (PF07009; HMM-score: 8.8)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 3.33
    • Cellwall Score: 3.33
    • Extracellular Score: 3.33
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.0007
    • Cytoplasmic Membrane Score: 0.6409
    • Cell wall & surface Score: 0.1136
    • Extracellular Score: 0.2448
  • LocateP: Lipid anchored
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPII)
    • Intracellular possibility: -0.33
    • Signal peptide possibility: 1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: VVLTACG
  • SignalP: Signal peptide LIPO(Sec/SPII) length 18 aa
    • SP(Sec/SPI): 0.000422
    • TAT(Tat/SPI): 0.000043
    • LIPO(Sec/SPII): 0.999392
    • Cleavage Site: CS pos: 18-19. LTA-CG. Pr: 0.9998
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MKLKSLAVLSMSAVVLTACGNDTPKDETKSTESNTNQDTNTTKDVIALKDVKTSPEDAVKKAEETYKGQKLKGISFENSNGEWAYKVTQQKSGEESEVLVADKNKKVINKKTEKEDTMNENDNFKYSDAIDYKKAIKEGQKEFDGDIKEWSLEKDDGKLVYNIDLKKGNKKQEVTVDAKNGKVLKSEQDH

Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Lipoprotein [1] [2] [3] [4] [5]
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator: SigB* (activation) regulon
    SigB*(sigma factor)controlling a large regulon involved in stress/starvation response and adaptation;  [6] [7]   other strains

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: 7.36 h [8]

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Kristina Hempel, Jan Pané-Farré, Andreas Otto, Susanne Sievers, Michael Hecker, Dörte Becher
    Quantitative cell surface proteome profiling for SigB-dependent protein expression in the human pathogen Staphylococcus aureus via biotinylation approach.
    J Proteome Res: 2010, 9(3);1579-90
    [PubMed:20108986] [WorldCat.org] [DOI] (I p)
  3. Annette Dreisbach, Kristina Hempel, Girbe Buist, Michael Hecker, Dörte Becher, Jan Maarten van Dijl
    Profiling the surfacome of Staphylococcus aureus.
    Proteomics: 2010, 10(17);3082-96
    [PubMed:20662103] [WorldCat.org] [DOI] (I p)
  4. Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J Proteome Res: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  5. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  6. Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
    Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
    J Bacteriol: 2004, 186(13);4085-99
    [PubMed:15205410] [WorldCat.org] [DOI] (P p)
  7. Jan Pané-Farré, Beate Jonas, Konrad Förstner, Susanne Engelmann, Michael Hecker
    The sigmaB regulon in Staphylococcus aureus and its regulation.
    Int J Med Microbiol: 2006, 296(4-5);237-58
    [PubMed:16644280] [WorldCat.org] [DOI] (P p)
  8. Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
    Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
    Mol Cell Proteomics: 2012, 11(9);558-70
    [PubMed:22556279] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]