From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0395 [new locus tag: SACOL_RS01990 ]
  • pan locus tag?: SAUPAN001856000
  • symbol: SACOL0395
  • pan gene symbol?: gcvH-L
  • synonym:
  • product: glycine cleavage system H protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL0395 [new locus tag: SACOL_RS01990 ]
  • symbol: SACOL0395
  • product: glycine cleavage system H protein
  • replicon: chromosome
  • strand: +
  • coordinates: 402086..402418
  • length: 333
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGAAAAAGTTAGCCAATTATTTATGGGTAGAAAAAGTAGGAGATTTGTATGTGTTTAGT
    ATGACACCTGAATTGCAAGATGATATTGGGACAGTAGGTTATGTTGAATTCGTAAGTCCA
    GATGAAGTTAAAGTGGATGATGAAATTGTGAGTATCGAAGCATCGAAAACGGTCATTGAT
    GTGCAAACGCCATTGTCAGGAACGATTATTGAGCGAAATACAAAAGCGGAAGAAGAACCG
    ACAATTTTAAACTCTGAAAAACCAGAAGAAAATTGGTTGTTCAAATTGGATGATGTCGAT
    AAAGAAGCATTCCTAGCATTACCGGAGGCTTAA
    60
    120
    180
    240
    300
    333

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL0395 [new locus tag: SACOL_RS01990 ]
  • symbol: SACOL0395
  • description: glycine cleavage system H protein
  • length: 110
  • theoretical pI: 3.86736
  • theoretical MW: 12421.9
  • GRAVY: -0.263636

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Energy metabolism Amino acids and amines glycine cleavage system H protein (TIGR00527; HMM-score: 57.2)
    and 3 more
    glycine cleavage protein H-like protein (TIGR03077; HMM-score: 38.6)
    Metabolism Energy metabolism TCA cycle dihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase (succinyl-transferring) complex (TIGR01347; EC 2.3.1.61; HMM-score: 18.3)
    Metabolism Central intermediary metabolism Nitrogen metabolism urea carboxylase (TIGR02712; EC 6.3.4.6; HMM-score: 9.4)
  • TheSEED  :
    • Biotinyl-lipoyl attachment domain protein, GcvH-like
  • PFAM:
    Hybrid (CL0105) GCV_H; Glycine cleavage H-protein (PF01597; HMM-score: 61.1)
    and 2 more
    Biotin_lipoyl; Biotin-requiring enzyme (PF00364; HMM-score: 17.8)
    no clan defined DUF6763; Family of unknown function (DUF6763) (PF20549; HMM-score: 13.3)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9941
    • Cytoplasmic Membrane Score: 0.0005
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0054
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.010765
    • TAT(Tat/SPI): 0.000132
    • LIPO(Sec/SPII): 0.000825
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MKKLANYLWVEKVGDLYVFSMTPELQDDIGTVGYVEFVSPDEVKVDDEIVSIEASKTVIDVQTPLSGTIIERNTKAEEEPTILNSEKPEENWLFKLDDVDKEAFLALPEA

Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Cytoplasmic [1]
  • quantitative data / protein copy number per cell: 272 [2]
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  2. Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)

Relevant publications[edit | edit source]

Johannes Gregor Matthias Rack, Rosa Morra, Eva Barkauskaite, Rolf Kraehenbuehl, Antonio Ariza, Yue Qu, Mary Ortmayer, Orsolya Leidecker, David R Cameron, Ivan Matic, Anton Y Peleg, David Leys, Ana Traven, Ivan Ahel
Identification of a Class of Protein ADP-Ribosylating Sirtuins in Microbial Pathogens.
Mol Cell: 2015, 59(2);309-20
[PubMed:26166706] [WorldCat.org] [DOI] (I p)