Jump to navigation
Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL0359 [new locus tag: SACOL_RS01805 ]
- pan locus tag?: SAUPAN001579000
- symbol: SACOL0359
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL0359 [new locus tag: SACOL_RS01805 ]
- symbol: SACOL0359
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 371768..371962
- length: 195
- essential: unknown
⊟Accession numbers[edit | edit source]
- Gene ID: 3236926 NCBI
- RefSeq: YP_185251 NCBI
- BioCyc: see SACOL_RS01805
- MicrobesOnline: 911830 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGACGGAAGTTAAAATTAAAACTATTTCAGGCGGAGTTTATTTTGTAAAAACGGCTGAA
CCTTTTGAAAAATATGTTGAAAGAATGACGAGTTTTAATGGTTATATTTACGCAAGTACT
ATAATCAAGAAACCAACGTATATTAAAACAGATACGATTGAATCAATCACACTTATTGAG
GAGCATGGGAAATGA60
120
180
195
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL0359 [new locus tag: SACOL_RS01805 ]
- symbol: SACOL0359
- description: hypothetical protein
- length: 64
- theoretical pI: 8.85701
- theoretical MW: 7340.46
- GRAVY: -0.223438
⊟Function[edit | edit source]
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9057
- Cytoplasmic Membrane Score: 0.0049
- Cell wall & surface Score: 0.0015
- Extracellular Score: 0.0879
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.009743
- TAT(Tat/SPI): 0.000421
- LIPO(Sec/SPII): 0.002101
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MTEVKIKTISGGVYFVKTAEPFEKYVERMTSFNGYIYASTIIKKPTYIKTDTIESITLIEEHGK
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p)