Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL0323 [new locus tag: SACOL_RS01630 ]
- pan locus tag?: SAUPAN001423000
- symbol: SACOL0323
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL0323 [new locus tag: SACOL_RS01630 ]
- symbol: SACOL0323
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 358451..358759
- length: 309
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3236937 NCBI
- RefSeq: YP_185215 NCBI
- BioCyc: see SACOL_RS01630
- MicrobesOnline: 911794 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGCAAGACCAATCATTAAAATTAGTAAAACTACAACTAAAATATCATAACCTTTCAGGA
CAAATTGAAGCTTATGATAAATCACTTAAAGAAATAAGATACACTCGAGATCTTTTCAAC
AAACATCTAAGCATGAATAACGAAGACGCATTTGCTGGTTTGGAAATGGTAGAAGATGAA
ATTACTAAAAAGCTACGAAGTGCTATCAAAGAGTTCCAAAAAGTAGTGAAAGCGTTAGAC
AAGCTTAACGGTGTTGAAAGCGATAACAAAGTTACTGATTTAACAGAGTGGCGGAAAGTG
AATCAGTAA60
120
180
240
300
309
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL0323 [new locus tag: SACOL_RS01630 ]
- symbol: SACOL0323
- description: hypothetical protein
- length: 102
- theoretical pI: 8.89148
- theoretical MW: 11943.6
- GRAVY: -0.761765
⊟Function[edit | edit source]
- TIGRFAM: rhombotail lipoprotein (TIGR04179; HMM-score: 12.7)
- TheSEED :
- Phage protein
- PFAM: no clan defined ATG17_like; Autophagy protein ATG17-like domain (PF04108; HMM-score: 16.7)DUF4164; Domain of unknown function (DUF4164) (PF13747; HMM-score: 14.9)APG6_N; Apg6 coiled-coil region (PF17675; HMM-score: 14.7)Prefoldin (CL0200) Prefoldin_2; Prefoldin subunit (PF01920; HMM-score: 14.2)no clan defined Trns_repr_metal; Metal-sensitive transcriptional repressor (PF02583; HMM-score: 13.8)and 1 moreTMF_DNA_bd; TATA element modulatory factor 1 DNA binding (PF12329; HMM-score: 12)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9065
- Cytoplasmic Membrane Score: 0.0038
- Cell wall & surface Score: 0.0006
- Extracellular Score: 0.0892
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002101
- TAT(Tat/SPI): 0.000314
- LIPO(Sec/SPII): 0.000538
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MQDQSLKLVKLQLKYHNLSGQIEAYDKSLKEIRYTRDLFNKHLSMNNEDAFAGLEMVEDEITKKLRSAIKEFQKVVKALDKLNGVESDNKVTDLTEWRKVNQ
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]