Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL0148 [new locus tag: SACOL_RS00750 ]
- pan locus tag?: SAUPAN000991000
- symbol: cap5M
- pan gene symbol?: capM
- synonym:
- product: capsular polysaccharide biosynthesis galactosyltransferase Cap5M
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL0148 [new locus tag: SACOL_RS00750 ]
- symbol: cap5M
- product: capsular polysaccharide biosynthesis galactosyltransferase Cap5M
- replicon: chromosome
- strand: +
- coordinates: 165991..166548
- length: 558
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3236734 NCBI
- RefSeq: YP_185048 NCBI
- BioCyc: see SACOL_RS00750
- MicrobesOnline: 911625 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541ATGAAGCGATTATTCGATGTAGTGAGTTCAATATATGGTTTAGTAGTTTTAAGTCCGATT
CTGTTAATTACAGCATTACTAATTAAAATGGAATCACCTGGACCAGCCATTTTCAAACAA
AAAAGACCGACGATTAATAATGAATTGTTTAATATTTATAAGTTTAGATCAATGAAAATA
GACACACCTAATGTTGCAACTGATTTAATGGATTCAACATCGTATATAACAAAGACAGGG
AAGGTCATTCGTAAGACCTCTATTGATGAATTGCCACAATTATTGAATGTTTTAAAAGGA
GAAATGTCAATTGTAGGTCCTAGACCAGCGCTTTATAATCAATACGAATTAATCGAAAAA
CGTACAAAAGCGAACGTGCATACGATTAGACCAGGTGTGACAGGACTAGCTCAAGTGATG
GGGAGAGATGATATCACTGATGATCAAAAAGTAGCGTATGATCATTATTACTTAACACAT
CAATCTATGATGCTTGATATGTATATCATATATAAAACAATTAAAAATATCGTTACTTCA
GAAGGTGTGCATCACTAA60
120
180
240
300
360
420
480
540
558
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL0148 [new locus tag: SACOL_RS00750 ]
- symbol: Cap5M
- description: capsular polysaccharide biosynthesis galactosyltransferase Cap5M
- length: 185
- theoretical pI: 9.71543
- theoretical MW: 21062.6
- GRAVY: -0.103784
⊟Function[edit | edit source]
- TIGRFAM: exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase (TIGR03025; HMM-score: 245.8)undecaprenyl-phosphate glucose phosphotransferase (TIGR03023; EC 2.7.8.-; HMM-score: 219.7)and 2 moreundecaprenyl-phosphate galactose phosphotransferase WbaP (TIGR03022; EC 2.7.8.6; HMM-score: 188.4)sugar transferase, PEP-CTERM system associated (TIGR03013; HMM-score: 170.9)
- TheSEED :
- Capsular polysaccharide synthesis enzyme CapM
- PFAM: no clan defined Bac_transf; Bacterial sugar transferase (PF02397; HMM-score: 206.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.01
- Cytoplasmic Membrane Score: 9.99
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helix: 1
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0016
- Cytoplasmic Membrane Score: 0.9942
- Cell wall & surface Score: 0
- Extracellular Score: 0.0042
- LocateP: N-terminally anchored (No CS)
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -0.5
- N-terminally Anchored Score: 4
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.166605
- TAT(Tat/SPI): 0.004108
- LIPO(Sec/SPII): 0.040317
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKRLFDVVSSIYGLVVLSPILLITALLIKMESPGPAIFKQKRPTINNELFNIYKFRSMKIDTPNVATDLMDSTSYITKTGKVIRKTSIDELPQLLNVLKGEMSIVGPRPALYNQYELIEKRTKANVHTIRPGVTGLAQVMGRDDITDDQKVAYDHYYLTHQSMMLDMYIIYKTIKNIVTSEGVHH
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Signal peptide containing [1] [2]
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulators: CodY (repression) regulon, SigB* (activation) regulon
CodY (TF) important in Amino acid metabolism; RegPrecise transcription unit transferred from N315 data RegPrecise SigB* (sigma factor) controlling a large regulon involved in stress/starvation response and adaptation; [5] [6] other strains
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Daniela Keinhörster, Shilpa Elizabeth George, Christopher Weidenmaier, Christiane Wolz
Function and regulation of Staphylococcus aureus wall teichoic acids and capsular polysaccharides.
Int J Med Microbiol: 2019, 309(6);151333
[PubMed:31362856] [WorldCat.org] [DOI] (I p) - ↑ S Sau, J Sun, C Y Lee
Molecular characterization and transcriptional analysis of type 8 capsule genes in Staphylococcus aureus.
J Bacteriol: 1997, 179(5);1614-21
[PubMed:9045821] [WorldCat.org] [DOI] (P p) - ↑ Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
J Bacteriol: 2004, 186(13);4085-99
[PubMed:15205410] [WorldCat.org] [DOI] (P p) - ↑ Jan Pané-Farré, Beate Jonas, Konrad Förstner, Susanne Engelmann, Michael Hecker
The sigmaB regulon in Staphylococcus aureus and its regulation.
Int J Med Microbiol: 2006, 296(4-5);237-58
[PubMed:16644280] [WorldCat.org] [DOI] (P p)