From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159JSNZLGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA2227
  • symbol: SA2227
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 2499033..2499446
  • length: 414
  • essential: no DEG

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    ATGTTAGTTTCATCAATTGCATTACTTATAGCAGCCTTGTTAAACTACATTTTCCCTAAT
    GCAATTCAACTATTCATATACGTTACAACGTTATCAACTGTGTTGTTTTTAGTTGTTTGG
    GCAATGATTATTGTCGCTTATCTAATGTATTTGAAAAAGCATCCTGAGGCACATAAAAAC
    AGTAAATTTAAGTTGATTGGTGGTAAGCCTATTGCTTACATTATTCTAGCGTTCTTCTTC
    TTTGTATTCATTTTATTATTCTTTAGTGACGAAACAAGAGCAGCTATTTATATTTCACCA
    TTCTGGTTTATATTTTTATTTTTCTTTTATAAAAAATACAAAACGAATGCTGAAAAGCTC
    GCGTATGAACAACGACAAAATGACAGCGGTCATTTCAGATATGACAATCAATAA
    60
    120
    180
    240
    300
    360
    414

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA2227
  • symbol: SA2227
  • description: hypothetical protein
  • length: 137
  • theoretical pI: 9.9069
  • theoretical MW: 16199.2
  • GRAVY: 0.641606

Function[edit | edit source]

  • TIGRFAM:
    undecaprenyl-phosphate glucose phosphotransferase (TIGR03023; EC 2.7.8.-; HMM-score: 12.8)
    Metabolism Transport and binding proteins Amino acids, peptides and amines GABA permease (TIGR01773; HMM-score: 10.5)
    Metabolism Energy metabolism Electron transport cytochrome c oxidase, subunit II (TIGR02866; EC 1.9.3.1; HMM-score: 10.4)
    and 1 more
    exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase (TIGR03025; HMM-score: 10.2)
  • TheSEED  :
    • D-serine/D-alanine/glycine transporter
    Amino Acids and Derivatives Alanine, serine, and glycine Glycine and Serine Utilization  D-serine/D-alanine/glycine transporter
    and 1 more
    Carbohydrates Central carbohydrate metabolism Pyruvate Alanine Serine Interconversions  D-serine/D-alanine/glycine transporter
  • PFAM:
    APC (CL0062) AA_permease; Amino acid permease (PF00324; HMM-score: 32)
    and 10 more
    AA_permease_2; Amino acid permease (PF13520; HMM-score: 19.8)
    no clan defined Oxidored_q3; NADH-ubiquinone/plastoquinone oxidoreductase chain 6 (PF00499; HMM-score: 17.2)
    Gx_transp (CL0315) ECF_trnsprt; ECF transporter, substrate-specific component (PF12822; HMM-score: 12.3)
    Transporter (CL0375) Amastin; Amastin surface glycoprotein (PF07344; HMM-score: 10.6)
    Peroxisome (CL0484) PRT_C; Plant phosphoribosyltransferase C-terminal (PF08372; HMM-score: 8.9)
    O-anti_assembly (CL0499) Wzy_C; O-Antigen ligase (PF04932; HMM-score: 8.8)
    no clan defined RAMP4; Ribosome associated membrane protein RAMP4 (PF06624; HMM-score: 8.7)
    DUF4131; Domain of unknown function (DUF4131) (PF13567; HMM-score: 8.6)
    DHHC; DHHC palmitoyltransferase (PF01529; HMM-score: 7.9)
    DPM3; Dolichol-phosphate mannosyltransferase subunit 3 (DPM3) (PF08285; HMM-score: 7.2)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 4
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.9999
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0001
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0
    • Signal peptide possibility: -0.5
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.000585
    • TAT(Tat/SPI): 0.000135
    • LIPO(Sec/SPII): 0.006131
  • predicted transmembrane helices (TMHMM): 4

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MLVSSIALLIAALLNYIFPNAIQLFIYVTTLSTVLFLVVWAMIIVAYLMYLKKHPEAHKNSKFKLIGGKPIAYIILAFFFFVFILLFFSDETRAAIYISPFWFIFLFFFYKKYKTNAEKLAYEQRQNDSGHFRYDNQ

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulators: CcpA regulon, CodY (repression) regulon

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]