Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA2161 [new locus tag: SA_RS12405 ]
- pan locus tag?: SAUPAN005889000
- symbol: SA2161
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA2161 [new locus tag: SA_RS12405 ]
- symbol: SA2161
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2428363..2428764
- length: 402
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1125089 NCBI
- RefSeq: NP_375484 NCBI
- BioCyc: see SA_RS12405
- MicrobesOnline: 104510 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGGTTAAAGTGACATATGATATTCCGACTTGCGAGGATTATTGCGCATTAAGGATTAAC
GCAGGTATGAGTCCAAAGACGCGCGAAGCAGCTGAAAAAGGATTACCTAATGCCTTATTT
ACAGTAACCTTGTATGATAAAGATCGGTTAATTGGTATGGGTAGAGTGATTGGCGATGGC
GGAACTGTTTTTCAAATTGTTGATATTGCTGTTTCGAAAAGTTATCAAGGTCAAGATTAC
GGCAGTCTAATTATGGAACATATTATGAAGTATATTAAAAATGTATCTGTCGAAAGTGCA
TACGTTAGTCTGATCGCAGACTACCCAGCGGATAAATTATATGCAAAATTTGGATTTATG
CCTACCGAACCAGATTCAGGCGGTATGTATATCAAATACTAA60
120
180
240
300
360
402
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA2161 [new locus tag: SA_RS12405 ]
- symbol: SA2161
- description: hypothetical protein
- length: 133
- theoretical pI: 5.15281
- theoretical MW: 14745.9
- GRAVY: -0.0586466
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Ribosomal proteins: synthesis and modification ribosomal-protein-alanine acetyltransferase (TIGR01575; EC 2.3.1.128; HMM-score: 30.1)
- TheSEED :
- Attachment and virulence protein AttT
- PFAM: Acetyltrans (CL0257) Acetyltransf_1; Acetyltransferase (GNAT) family (PF00583; HMM-score: 45.8)Acetyltransf_10; Acetyltransferase (GNAT) domain (PF13673; HMM-score: 45.2)Acetyltransf_7; Acetyltransferase (GNAT) domain (PF13508; HMM-score: 43.6)and 5 moreGNAT_acetyltr_2; GNAT acetyltransferase 2 (PF13718; HMM-score: 15.2)FR47; FR47-like protein (PF08445; HMM-score: 14.9)IDM1_C; Increased DNA methylation 1, C-terminal (PF23209; HMM-score: 13.9)Acetyltransf_9; Acetyltransferase (GNAT) domain (PF13527; HMM-score: 13.8)Acetyltransf_CG; GCN5-related N-acetyl-transferase (PF14542; HMM-score: 12.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.8919
- Cytoplasmic Membrane Score: 0.0016
- Cell wall & surface Score: 0.0002
- Extracellular Score: 0.1063
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.011018
- TAT(Tat/SPI): 0.000215
- LIPO(Sec/SPII): 0.001369
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MVKVTYDIPTCEDYCALRINAGMSPKTREAAEKGLPNALFTVTLYDKDRLIGMGRVIGDGGTVFQIVDIAVSKSYQGQDYGSLIMEHIMKYIKNVSVESAYVSLIADYPADKLYAKFGFMPTEPDSGGMYIKY
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- data available for JSNZ
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]