From AureoWiki
Jump to navigation Jump to search

NCBI: 26-AUG-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0754 [new locus tag: SA_RS04300 ]
  • pan locus tag?: SAUPAN002813000
  • symbol: SA0754
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA0754 [new locus tag: SA_RS04300 ]
  • symbol: SA0754
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 861797..862291
  • length: 495
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGATTGAAATTAAAACATTAACGAATAATGATTTTAATGAGTATAAGAGACTTGTTTCG
    ACAGTCAATGAAGAATTCACTCAAGATTCACATTATAGTCAAACAATGACTGACACCTTA
    ATACATGACATTTTAAATCAAGGTTCACCGAAATGTATTGTATTTGGCTGTTATGAAAAC
    GAAACACTTATCGCAACAGCTGCCTTAGAACAAATTCGATACGTTGGAAAAGAACATAAA
    TCATTAATTAAATACAACTTTGTTACTAATAACGATAAATCGATTAATAGCGAGCTCATT
    AATTTCATTATTAATTATGCACGGCAGAACAATTACGAATCTTTACTTACATCAATTGTG
    TCAAACAACATAGGTGCTAAAGTTTTCTATAGTGCACTAGGATTCGACATTCTTGGTTTT
    GAGAAAAATGCAATTAAAATCGGAAATACCTATTTCGATGAACATTGGCTTTTTTATGAT
    TTGATTAATAAGTAA
    60
    120
    180
    240
    300
    360
    420
    480
    495

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA0754 [new locus tag: SA_RS04300 ]
  • symbol: SA0754
  • description: hypothetical protein
  • length: 164
  • theoretical pI: 4.96545
  • theoretical MW: 18962.2
  • GRAVY: -0.278659

Function[edit | edit source]

  • TIGRFAM:
    UDP-4-amino-4,6-dideoxy-N-acetyl-beta-L-altrosamine N-acetyltransferase (TIGR03585; EC 2.3.1.202; HMM-score: 15.7)
  • TheSEED  :
    • FIG01108288: hypothetical protein
  • PFAM:
    Acetyltrans (CL0257) Acetyltransf_4; Acetyltransferase (GNAT) domain (PF13420; HMM-score: 168.7)
    and 8 more
    Acetyltransf_1; Acetyltransferase (GNAT) family (PF00583; HMM-score: 24.4)
    Acetyltransf_7; Acetyltransferase (GNAT) domain (PF13508; HMM-score: 14.5)
    FeeM; N-acyl amino acid synthase FeeM (PF21926; HMM-score: 14.3)
    Acetyltransf_10; Acetyltransferase (GNAT) domain (PF13673; HMM-score: 14)
    AMP-binding_C (CL0531) Mug62; Meiotically up-regulated gene 62 protein-like domain (PF24919; HMM-score: 13.6)
    Acetyltrans (CL0257) Autoind_synth; Autoinducer synthase (PF00765; HMM-score: 13.2)
    Acetyltransf_9; Acetyltransferase (GNAT) domain (PF13527; HMM-score: 12.8)
    no clan defined eIF3_subunit; Translation initiation factor eIF3 subunit (PF08597; HMM-score: 12.7)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9769
    • Cytoplasmic Membrane Score: 0.0015
    • Cell wall & surface Score: 0.0003
    • Extracellular Score: 0.0213
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.010781
    • TAT(Tat/SPI): 0.000381
    • LIPO(Sec/SPII): 0.0009
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MIEIKTLTNNDFNEYKRLVSTVNEEFTQDSHYSQTMTDTLIHDILNQGSPKCIVFGCYENETLIATAALEQIRYVGKEHKSLIKYNFVTNNDKSINSELINFIINYARQNNYESLLTSIVSNNIGAKVFYSALGFDILGFEKNAIKIGNTYFDEHWLFYDLINK

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • data available for JSNZ

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]