From AureoWiki
Jump to navigation Jump to search

NCBI: 26-AUG-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0662
  • pan locus tag?: SAUPAN002593000
  • symbol: SA0662
  • pan gene symbol?: saeQ
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA0662
  • symbol: SA0662
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 756996..757178
  • length: 183
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGATAAATTATATCTTAGCAGATATGATATTTACGTATCCTCTTCAATTAACTTTCTTT
    ATCCTTTTACTAATGAGTCACTCATTGTTAAAACAGATTTCACTTAAAGAAATCATTAAT
    TACTTTAGAGGTCGTAAGAACAGAGGTGAAAAAATAGATGACCCACTTACTGATCGTGGA
    TGA
    60
    120
    180
    183

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA0662
  • symbol: SA0662
  • description: hypothetical protein
  • length: 60
  • theoretical pI: 9.66267
  • theoretical MW: 7119.42
  • GRAVY: 0.0766667

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • FIG01108426: hypothetical protein
  • PFAM:
    TPR (CL0020) HEAT_ATR; Serine/threonine-protein kinase ATR-like, HEAT repeats (PF23593; HMM-score: 14.2)
    Triple_barrel (CL0662) RNase_H2_suC; Ribonuclease H2 non-catalytic subunit (Ylr154p-like) (PF08615; HMM-score: 13)
    no clan defined MotB_plug; Membrane MotB of proton-channel complex MotA/MotB (PF13677; HMM-score: 13)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helix: 1
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.0041
    • Cytoplasmic Membrane Score: 0.9621
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0338
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 4
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.101357
    • TAT(Tat/SPI): 0.001291
    • LIPO(Sec/SPII): 0.019422
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MINYILADMIFTYPLQLTFFILLLMSHSLLKQISLKEIINYFRGRKNRGEKIDDPLTDRG

Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator: SaeR (activation) regulon
    SaeR(TF)important in Virulence; RegPrecise 

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]