Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA0493 [new locus tag: SA_RS02895 ]
- pan locus tag?: SAUPAN002304000
- symbol: secE
- pan gene symbol?: secE
- synonym:
- product: preprotein translocase subunit SecE
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA0493 [new locus tag: SA_RS02895 ]
- symbol: secE
- product: preprotein translocase subunit SecE
- replicon: chromosome
- strand: +
- coordinates: 575193..575375
- length: 183
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1123297 NCBI
- RefSeq: NP_373745 NCBI
- BioCyc: see SA_RS02895
- MicrobesOnline: 102771 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGGCTAAAAAAGAAAGTTTCTTTAAAGGCGTTAAGTCTGAAATGGAAAAAACAAGTTGG
CCGACGAAAGAAGAGCTATTTAAATATACTGTAATTGTAGTTTCTACTGTTATATTCTTC
TTAGTCTTTTTCTATGCCTTAGATTTAGGAATTACAGCATTGAAAAATTTATTATTTGGT
TAG60
120
180
183
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA0493 [new locus tag: SA_RS02895 ]
- symbol: SecE
- description: preprotein translocase subunit SecE
- length: 60
- theoretical pI: 9.66311
- theoretical MW: 6932.22
- GRAVY: 0.47
⊟Function[edit | edit source]
- TIGRFAM: Protein fate Protein and peptide secretion and trafficking preprotein translocase, SecE subunit (TIGR00964; HMM-score: 76.9)and 1 moreHAD ATPase, P-type, family IC (TIGR01494; EC 3.6.3.-; HMM-score: 12)
- TheSEED :
- Protein translocase subunit SecE
- PFAM: no clan defined SecE; SecE/Sec61-gamma subunits of protein translocation complex (PF00584; HMM-score: 70)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helix: 1
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9979
- Cell wall & surface Score: 0
- Extracellular Score: 0.0021
- LocateP: N-terminally anchored (No CS)
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -1
- N-terminally Anchored Score: 7
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.004468
- TAT(Tat/SPI): 0.000132
- LIPO(Sec/SPII): 0.001904
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MAKKESFFKGVKSEMEKTSWPTKEELFKYTVIVVSTVIFFLVFFYALDLGITALKNLLFG
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]