Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA0409 [new locus tag: SA_RS02335 ]
- pan locus tag?: SAUPAN002154000
- symbol: SA0409
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA0409 [new locus tag: SA_RS02335 ]
- symbol: SA0409
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 467758..467958
- length: 201
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1123193 NCBI
- RefSeq: NP_373660 NCBI
- BioCyc: see SA_RS02335
- MicrobesOnline: 102686 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATAAACATGTTATTTGTCATTTTAGTTTTATATGTCATTGGCATTGCATTTATTCTACTA
AGTGTTTTTGGTTCTAAGACGGAAGGTTTATCTACGAAACATACTTTATATACAATTGGT
AGTGCCATTATAACGATTGCTATTTTCATTTCAATTGGCTATGCTATTCAATACTTAACT
GCAGCGCTTTATGGTTTGTAA60
120
180
201
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA0409 [new locus tag: SA_RS02335 ]
- symbol: SA0409
- description: hypothetical protein
- length: 66
- theoretical pI: 8.9132
- theoretical MW: 7146.61
- GRAVY: 1.45455
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- FIG01108079: hypothetical protein
- PFAM: no clan defined HILPDA; Hypoxia-inducible lipid droplet-associated (PF15220; HMM-score: 14.1)ABC-2 (CL0181) ABC2_membrane_5; ABC-2 family transporter protein (PF13346; HMM-score: 11.4)and 2 moreno clan defined Holin_SPP1; SPP1 phage holin (PF04688; HMM-score: 10.1)ABC-2 (CL0181) ABC2_membrane_3; ABC-2 family transporter protein (PF12698; HMM-score: 9.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helices: 2
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9662
- Cell wall & surface Score: 0
- Extracellular Score: 0.0338
- LocateP: Multi-transmembrane
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: 0
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.083517
- TAT(Tat/SPI): 0.000532
- LIPO(Sec/SPII): 0.127354
- predicted transmembrane helices (TMHMM): 2
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MNMLFVILVLYVIGIAFILLSVFGSKTEGLSTKHTLYTIGSAIITIAIFISIGYAIQYLTAALYGL
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- data available for JSNZ
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.