Jump to navigation
Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA0300
- pan locus tag?: SAUPAN001235000
- symbol: SA0300
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA0300
- symbol: SA0300
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 355764..356006
- length: 243
- essential: no DEG
⊟Accession numbers[edit | edit source]
- Gene ID: 1123079 NCBI
- RefSeq: NP_373546 NCBI
- BioCyc:
- MicrobesOnline: 102572 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATCAAGTCAGTTATGCCATCAAATAGTGTGAAAGATGTTACAGGTGCAGGCGATTCATTC
TGTGCTGCAGTAGTATATAGCTGGTTAAATGGGATGTCTACTGAAGATATATTAATTGCT
GGTATGGTTAACGCAAAGAAAACGATAGAAACGAAATATACAGTTAGGCAAAACCTAGAT
CAACAGCAACTTTATCACGATATGGAGGATTATAAAAATGGCAAATTTACAAAAGTATAT
TGA60
120
180
240
243
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA0300
- symbol: SA0300
- description: hypothetical protein
- length: 80
- theoretical pI: 7.34389
- theoretical MW: 9005.21
- GRAVY: -0.4125
⊟Function[edit | edit source]
- TIGRFAM: hexose kinase, 1-phosphofructokinase family (TIGR03168; EC 2.7.1.-; HMM-score: 25.5)1-phosphofructokinase (TIGR03828; EC 2.7.1.56; HMM-score: 23)Energy metabolism Sugars 5-dehydro-2-deoxygluconokinase (TIGR04382; EC 2.7.1.92; HMM-score: 21.6)and 2 moreEnergy metabolism Sugars ribokinase (TIGR02152; EC 2.7.1.15; HMM-score: 16.9)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides bifunctional protein RfaE, domain I (TIGR02198; EC 2.7.1.-; HMM-score: 16.2)
- TheSEED :
- Pseudouridine kinase (EC 2.7.1.83)
- PFAM: Ribokinase (CL0118) PfkB; pfkB family carbohydrate kinase (PF00294; HMM-score: 40.8)and 1 moreno clan defined Rab3-GTPase_cat; Rab3 GTPase-activating protein catalytic subunit (PF13890; HMM-score: 11.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.017008
- TAT(Tat/SPI): 0.001803
- LIPO(Sec/SPII): 0.00192
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKSVMPSNSVKDVTGAGDSFCAAVVYSWLNGMSTEDILIAGMVNAKKTIETKYTVRQNLDQQQLYHDMEDYKNGKFTKVY
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: SA0300 > SA0301 > SA0302
⊟Regulation[edit | edit source]
- regulator: CcpA regulon
CcpA (TF) important in Carbon catabolism; RegPrecise
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.