From AureoWiki
Jump to navigation Jump to search

NCBI: 26-AUG-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0160 [new locus tag: SA_RS00970 ]
  • pan locus tag?: SAUPAN001001000
  • symbol: SA0160
  • pan gene symbol?: isdI
  • synonym:
  • product: heme-degrading monooxygenase IsdI

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA0160 [new locus tag: SA_RS00970 ]
  • symbol: SA0160
  • product: heme-degrading monooxygenase IsdI
  • replicon: chromosome
  • strand: -
  • coordinates: 184042..184368
  • length: 327
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGTTTATGGCAGAAAATAGATTACAATTACAAAAAGGCAGTGCGGAAGAAACGATTGAA
    CGTTTTTACAATAGACAAGGCATTGAAACTATTGAAGGCTTCCAACAAATGTTTGTCACT
    AAAACATTAAATACCGAGGATACAGACGAAGTTAAAATCTTAACTATTTGGGAATCTGAA
    GATAGCTTTAATAATTGGTTGAATTCCGATGTATTTAAAGAAGCTCATAAAAATGTACGT
    TTAAAAAGTGATGACGATGGACAGCAAAGTCCAATATTATCAAATAAAGTATTCAAATAT
    GATATTGGCTACCACTATCAAAAATAA
    60
    120
    180
    240
    300
    327

Protein[edit | edit source]

Protein Data Bank: 2ZDP
Protein Data Bank: 3LGM
Protein Data Bank: 3LGN
Protein Data Bank: 3QGP
Protein Data Bank: 4FNH
Protein Data Bank: 4FNI

General[edit | edit source]

  • locus tag: SA0160 [new locus tag: SA_RS00970 ]
  • symbol: SA0160
  • description: heme-degrading monooxygenase IsdI
  • length: 108
  • theoretical pI: 4.60532
  • theoretical MW: 12791.1
  • GRAVY: -0.863889

Function[edit | edit source]

  • reaction:
    EC 1.14.99.3?  ExPASy
    Transferred entry: 1.14.14.18
    EC 1.14.99.48?  ExPASy
    Heme oxygenase (staphylobilin-producing) Protoheme + 5 reduced acceptor + 4 O2 = 5-oxo-delta-bilirubin + Fe2+ + formaldehyde + 5 acceptor + 4 H2O Protoheme + 5 reduced acceptor + 4 O2 = 15-oxo-beta-bilirubin + Fe2+ + formaldehyde + 5 acceptor + 4 H2O
  • TIGRFAM:
  • TheSEED  :
    • Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48)
    Iron acquisition and metabolism Iron acquisition and metabolism - no subcategory Heme, hemin uptake and utilization systems in GramPositives  Heme-degrading cytoplasmic oxygenase IsdI
  • PFAM:
    Dim_A_B_barrel (CL0032) ABM; Antibiotic biosynthesis monooxygenase (PF03992; HMM-score: 61)
    and 1 more
    Dehydratase_hem; Haem-containing dehydratase (PF13816; HMM-score: 13.6)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.67
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 0.15
    • Extracellular Score: 0.17
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9919
    • Cytoplasmic Membrane Score: 0.0043
    • Cell wall & surface Score: 0.0004
    • Extracellular Score: 0.0034
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.002156
    • TAT(Tat/SPI): 0.001183
    • LIPO(Sec/SPII): 0.000315
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MFMAENRLQLQKGSAEETIERFYNRQGIETIEGFQQMFVTKTLNTEDTDEVKILTIWESEDSFNNWLNSDVFKEAHKNVRLKSDDDGQQSPILSNKVFKYDIGYHYQK

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • data available for JSNZ

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]

Woo Cheol Lee, Michelle L Reniere, Eric P Skaar, Michael E P Murphy
Ruffling of metalloporphyrins bound to IsdG and IsdI, two heme-degrading enzymes in Staphylococcus aureus.
J Biol Chem: 2008, 283(45);30957-63
[PubMed:18713745] [WorldCat.org] [DOI] (P p)
Michelle L Reniere, Georgia N Ukpabi, S Reese Harry, Donald F Stec, Robert Krull, David W Wright, Brian O Bachmann, Michael E Murphy, Eric P Skaar
The IsdG-family of haem oxygenases degrades haem to a novel chromophore.
Mol Microbiol: 2010, 75(6);1529-38
[PubMed:20180905] [WorldCat.org] [DOI] (I p)