From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159JSNZLGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS15160 [old locus tag: NWMN_0537 ]
  • pan locus tag?: SAUPAN002351000
  • symbol: NWMN_RS15160
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_RS15160 [old locus tag: NWMN_0537 ]
  • symbol: NWMN_RS15160
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 623344..623637
  • length: 294
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NC_009641 (623344..623637) NCBI
  • BioCyc:
  • MicrobesOnline: see NWMN_0537

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    TTGTCCAACGCAATTAATATTGAGACTCTAACCTTCAATATTATTATAGAGAACACAAAC
    TTAAATAGATTGGGTGACTTATTTGTGTCAGTTATTGCGATTGCGATAACTTCTTTTCTC
    TATATACATATAGTAACGTCTTATCTAATAAAAAACATGGTACTACAGTATCAAATTTAT
    CTAGGGCTTAAGTTTGATTTTTATAATAGGCAGGTTTACCTGATAAAAATACTTATTCAT
    TATATAATGTTAACAATATGTATTTTAAAGTTTACATTGAGTGAGGGATATTGA
    60
    120
    180
    240
    294

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_RS15160 [old locus tag: NWMN_0537 ]
  • symbol: NWMN_RS15160
  • description: hypothetical protein
  • length: 97
  • theoretical pI: 8.41466
  • theoretical MW: 11361.5
  • GRAVY: 0.805155

Function[edit | edit source]

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helix: 1
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.3346
    • Cytoplasmic Membrane Score: 0.3782
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.2871
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.000337
    • TAT(Tat/SPI): 0.000058
    • LIPO(Sec/SPII): 0.000552
  • predicted transmembrane helices (TMHMM): 2

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MSNAINIETLTFNIIIENTNLNRLGDLFVSVIAIAITSFLYIHIVTSYLIKNMVLQYQIYLGLKFDFYNRQVYLIKILIHYIMLTICILKFTLSEGY

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]