From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS12225 [old locus tag: NWMN_2112 ]
  • pan locus tag?: SAUPAN005631000
  • symbol: NWMN_RS12225
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_RS12225 [old locus tag: NWMN_2112 ]
  • symbol: NWMN_RS12225
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2350913..2351095
  • length: 183
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NC_009641 (2350913..2351095) NCBI
  • BioCyc:
  • MicrobesOnline: see NWMN_2112

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    TTGAAAGATTCTATATTTTGGAAGAAAGCTTTTATTCCTGTTTATTTTATTGTTGCGATG
    CTGGTGTTTCTACTTTTTAGGTTTTATATTAAAACAGATAACTTTTCTATATATTTAATG
    AGTATCTTCTTAATTTGTTTAGGAACTGCTTCTATCATTTATAACTATAAAACCAATCGA
    TAA
    60
    120
    180
    183


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_RS12225 [old locus tag: NWMN_2112 ]
  • symbol: NWMN_RS12225
  • description: hypothetical protein
  • length: 60
  • theoretical pI: 10.0374
  • theoretical MW: 7233.75
  • GRAVY: 0.853333

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED: see NWMN_2112
  • PFAM:
    E-set (CL0159) bCoV_NS7A; Betacoronavirus NS7A protein (PF08779; HMM-score: 13.1)
    no clan defined CLLAC; CLLAC-motif containing domain (PF15675; HMM-score: 13.1)
    Smim3; Small integral membrane protein 3 (PF17307; HMM-score: 12.3)
    DUF4131; Domain of unknown function (DUF4131) (PF13567; HMM-score: 11.4)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 2
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.998
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.002
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.004019
    • TAT(Tat/SPI): 0.00019
    • LIPO(Sec/SPII): 0.010505
  • predicted transmembrane helices (TMHMM): 2

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MKDSIFWKKAFIPVYFIVAMLVFLLFRFYIKTDNFSIYLMSIFLICLGTASIIYNYKTNR

Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]