From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS10740 [old locus tag: NWMN_1869 ]
  • pan locus tag?: SAUPAN004999000
  • symbol: NWMN_RS10740
  • pan gene symbol?: pmtA
  • synonym:
  • product: ABC transporter ATP-binding protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_RS10740 [old locus tag: NWMN_1869 ]
  • symbol: NWMN_RS10740
  • product: ABC transporter ATP-binding protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2081742..2082638
  • length: 897
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

  • Location: NC_009641 (2081742..2082638) NCBI
  • BioCyc:
  • MicrobesOnline: see NWMN_1869

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    ATGAATGCCATAGAATTAAGTAATGTTAATTATTCAAGTGATCAGTTTAATTTAAAGAAT
    ATCTCTTTCAAAGTTCCTCAAGGATTCGTCACTGGTTTTATTGGTAGAAATGGCGCTGGT
    AAAACCACAATAATAAGGTTAATTATGGATTTGTATCAACCACAAACTGGTGTTATTAGA
    GTATTAGAAGAGGATATGGCTCTCAATCCGATAGAGTTAAAGAATAGAATTGGGTTTGTT
    TACTCTGAAAATTATTTTAATGAGAGATGGACTACGAAGCAACTTGAAAAAATGATTGCC
    CCTTTTTATCGTAAATGGGACCATCAAGTATTTGAATTTTATCTTGAAAAGTTCGATTTA
    CCAATCAATAAATCAATAAAAACATTTTCGACTGGGATGAAAATGAAATTATCACTAGCA
    GTTGCATTTTCACATCATGCTGAATTGTATATTTTTGATGAGCCTACTTCAGGTCTTGAT
    CCCTTAGCTAGAAATGAGCTATTGGAGATAATTCAGCAAGAATTAATTGATGAAAATAAA
    ACAATATTCATGTCGACACACATTATCTCAGATTTAGAAAAAATAGCTGATTATATCATT
    CACTTAAGTGACGGTGAAGTTATCTTAAATGGTTCAAAAGAACAACTGTTACAAAGATAT
    CAAGTTGTGAGTGGTGCTATTGAGGACCTTGATGATGAATTAGCATCTCTACTTATTTAT
    GAAGAACATAAGCGTACGGGATTTATAGGATTAACAGAACATGCGCAAGTATTTAAAGAA
    ATTTTAGGTCATAAAGTGAATATCACTACACCTTCTATTGAGAACTTAATGGTTTATCTT
    GAAAAGAGAAAACCTAAATATCATGAAAACATCAAATTGATGGAAGAAGGTTTTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    897

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: NWMN_RS10740 [old locus tag: NWMN_1869 ]
  • symbol: NWMN_RS10740
  • description: ABC transporter ATP-binding protein
  • length: 298
  • theoretical pI: 5.25888
  • theoretical MW: 34520.4
  • GRAVY: -0.242282

⊟Function[edit | edit source]

  • TIGRFAM:
    Metabolism Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 145)
    and 76 more
    gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 112.5)
    lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 109.5)
    Metabolism Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 106.1)
    Cellular processes Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 102.1)
    Metabolism Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 102.1)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 100.7)
    Cellular processes Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 100.6)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 100.6)
    Metabolism Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 95.7)
    Metabolism Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 87.2)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 86.9)
    Metabolism Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 86.9)
    Metabolism Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 79.5)
    thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 78.2)
    Metabolism Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 76.5)
    proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 75.9)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 75.5)
    Metabolism Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 73.2)
    Cellular processes Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 71.7)
    ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 71.7)
    Metabolism Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 71.6)
    Metabolism Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 70.8)
    Metabolism Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 67.6)
    Metabolism Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 66.5)
    Cellular processes Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 65.9)
    Metabolism Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 65.9)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 65.8)
    Genetic information processing Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 65.8)
    Metabolism Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 65.8)
    ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 65.3)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 65.1)
    Metabolism Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 65.1)
    Metabolism Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 63.5)
    Metabolism Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 62)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 61.3)
    Metabolism Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 61.3)
    Metabolism Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 61.2)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 60.6)
    Metabolism Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 60)
    Metabolism Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 60)
    Metabolism Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 59.9)
    Cellular processes Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 59.9)
    Metabolism Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 59.9)
    Metabolism Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 59.8)
    D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 58.9)
    ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 58.6)
    Metabolism Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 58.2)
    Metabolism Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 58.2)
    Metabolism Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 58.1)
    thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 57.2)
    ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 57)
    2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 56.5)
    Metabolism Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 56.3)
    Metabolism Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 56.1)
    Metabolism Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 56.1)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 53.9)
    Cellular processes Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 52.9)
    Metabolism Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 52.9)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 52.5)
    Metabolism Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 51.9)
    phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 49.5)
    Metabolism Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 44.4)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 43.9)
    Metabolism Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 43.6)
    Genetic information processing DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 43)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 41.8)
    Metabolism Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 40.6)
    Metabolism Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 35.9)
    Metabolism Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 27.7)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 17.3)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Pantothenate and coenzyme A dephospho-CoA kinase (TIGR00152; EC 2.7.1.24; HMM-score: 16.1)
    Genetic information processing DNA metabolism Other MutS2 family protein (TIGR01069; HMM-score: 15.4)
    Genetic information processing Protein synthesis tRNA and rRNA base modification tRNA threonylcarbamoyl adenosine modification protein YjeE (TIGR00150; HMM-score: 14.4)
    Genetic information processing DNA metabolism DNA replication, recombination, and repair DNA replication and repair protein RecF (TIGR00611; HMM-score: 12.8)
    Genetic information processing Protein fate Protein modification and repair hydrogenase maturation peptidase HycI (TIGR00142; EC 3.4.23.-; HMM-score: 12.7)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin cobalamin biosynthesis protein CobW (TIGR02475; HMM-score: 11.2)
  • TheSEED: data available for COL, N315, NCTC8325, USA300_FPR3757
  • PFAM:
    P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 88.8)
    and 12 more
    AAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 51.1)
    no clan defined DUF4941; Domain of unknown function (DUF4941) (PF16299; HMM-score: 18.7)
    P-loop_NTPase (CL0023) AAA_15; AAA ATPase domain (PF13175; HMM-score: 18.4)
    SMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 18.2)
    AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 16.7)
    AAA_13; AAA domain (PF13166; HMM-score: 16)
    AAA_23; AAA domain (PF13476; HMM-score: 14.9)
    RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 13.7)
    PhoU (CL0297) PhoU; PhoU domain (PF01895; HMM-score: 13.2)
    P-loop_NTPase (CL0023) AAA_18; AAA domain (PF13238; HMM-score: 12.7)
    AAA_30; AAA domain (PF13604; HMM-score: 12.7)
    Zeta_toxin; Zeta toxin (PF06414; HMM-score: 12.4)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 1.05
    • Cytoplasmic Membrane Score: 8.78
    • Cellwall Score: 0.08
    • Extracellular Score: 0.09
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.00282
    • TAT(Tat/SPI): 0.000259
    • LIPO(Sec/SPII): 0.000319
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MNAIELSNVNYSSDQFNLKNISFKVPQGFVTGFIGRNGAGKTTIIRLIMDLYQPQTGVIRVLEEDMALNPIELKNRIGFVYSENYFNERWTTKQLEKMIAPFYRKWDHQVFEFYLEKFDLPINKSIKTFSTGMKMKLSLAVAFSHHAELYIFDEPTSGLDPLARNELLEIIQQELIDENKTIFMSTHIISDLEKIADYIIHLSDGEVILNGSKEQLLQRYQVVSGAIEDLDDELASLLIYEEHKRTGFIGLTEHAQVFKEILGHKVNITTPSIENLMVYLEKRKPKYHENIKLMEEGF

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • data available for N315

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=NWMN_RS10740&oldid=84273"