From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS06310 [old locus tag: NWMN_1117 ]
  • pan locus tag?: SAUPAN003487000
  • symbol: NWMN_RS06310
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_RS06310 [old locus tag: NWMN_1117 ]
  • symbol: NWMN_RS06310
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1223523..1223735
  • length: 213
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NC_009641 (1223523..1223735) NCBI
  • BioCyc:
  • MicrobesOnline: see NWMN_1117

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGAATGACAAAACATCTAATGATTTATATGGGAAGATAAAACATTGTAACGAATTTATC
    AATCATTCAAATGATTCCAATCTATCTAGTAGTCACGATGTCGACGAAAGTTCAACGAAG
    CAAAAACATATAAAAAATAAAACAACTATAGATCATAATGATGATTTATTTAAACATGTA
    AAGGATATATTACGTAAACAAGAACAAATTTAA
    60
    120
    180
    213

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_RS06310 [old locus tag: NWMN_1117 ]
  • symbol: NWMN_RS06310
  • description: hypothetical protein
  • length: 70
  • theoretical pI: 7.16119
  • theoretical MW: 8178.92
  • GRAVY: -1.33571

Function[edit | edit source]

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.5607
    • Cytoplasmic Membrane Score: 0
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.4392
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.010192
    • TAT(Tat/SPI): 0.00103
    • LIPO(Sec/SPII): 0.003725
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MNDKTSNDLYGKIKHCNEFINHSNDSNLSSSHDVDESSTKQKHIKNKTTIDHNDDLFKHVKDILRKQEQI

Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]