⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_RS06150 [old locus tag: NWMN_2620 ]
- pan locus tag?: SAUPAN003441000
- symbol: NWMN_RS06150
- pan gene symbol?: psmβ2
- synonym: psmB2
- product: hemolytic protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_RS06150 [old locus tag: NWMN_2620 ]
- symbol: NWMN_RS06150
- product: hemolytic protein
- replicon: chromosome
- strand: +
- coordinates: 1188599..1188733
- length: 135
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NC_009641 (1188599..1188733) NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121ATGACTGGACTAGCAGAAGCAATCGCAAATACTGTGCAAGCTGCACAACAACATGATAGT
GTGAAATTAGGCACAAGTATCGTAGACATCGTTGCTAACGGTGTGGGTTTACTAGGTAAA
TTATTTGGATTCTAA60
120
135
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_RS06150 [old locus tag: NWMN_2620 ]
- symbol: NWMN_RS06150
- description: hemolytic protein
- length: 44
- theoretical pI: 5.51933
- theoretical MW: 4456.1
- GRAVY: 0.606818
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: see NWMN_2620
- PFAM: no clan defined PSMbeta; Phenol-soluble modulin beta protein (PF05480; HMM-score: 82.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0.0051
- Cytoplasmic Membrane Score: 0.0519
- Cell wall & surface Score: 0.0012
- Extracellular Score: 0.9418
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.171987
- TAT(Tat/SPI): 0.00759
- LIPO(Sec/SPII): 0.014954
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MTGLAEAIANTVQAAQQHDSVKLGTSIVDIVANGVGLLGKLFGF
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: AgrA see NWMN_2620
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]
Rong Wang, Kevin R Braughton, Dorothee Kretschmer, Thanh-Huy L Bach, Shu Y Queck, Min Li, Adam D Kennedy, David W Dorward, Seymour J Klebanoff, Andreas Peschel, Frank R DeLeo, Michael Otto
Identification of novel cytolytic peptides as key virulence determinants for community-associated MRSA.
Nat Med: 2007, 13(12);1510-4
[PubMed:17994102] [WorldCat.org] [DOI] (I p)Shu Y Queck, Max Jameson-Lee, Amer E Villaruz, Thanh-Huy L Bach, Burhan A Khan, Daniel E Sturdevant, Stacey M Ricklefs, Min Li, Michael Otto
RNAIII-independent target gene control by the agr quorum-sensing system: insight into the evolution of virulence regulation in Staphylococcus aureus.
Mol Cell: 2008, 32(1);150-8
[PubMed:18851841] [WorldCat.org] [DOI] (I p)Michael Otto
Staphylococcus aureus toxins.
Curr Opin Microbiol: 2014, 17;32-7
[PubMed:24581690] [WorldCat.org] [DOI] (I p)