Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_RS05855 [old locus tag: NWMN_1034 ]
- pan locus tag?: SAUPAN001701000
- symbol: NWMN_RS05855
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_RS05855 [old locus tag: NWMN_1034 ]
- symbol: NWMN_RS05855
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 1135508..1135807
- length: 300
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGTTTGGATTTACCAAACGACACGAACAAGATTGGCGTTTAACGCGATTAGAAGAAAAT
GATAAGACTATGTTTGAAAAATTCGACAGAATAGAAGACAGTCTGAGAACGCAAGAAAAA
ATTTATGACAAGTTAGATAGAAATTTCGAAGAACTAAGGCGTGACAAGGTAGAAGATGAA
AAGAATAAAGAAAAGAATGCTAAGAATATTAGAGACATAAAAATGTGGATTCTCGGTTTG
ATAGGGACTATCTTCAGTACGATTGTCATAGCTTTACTAAGAACTATTTTTGGTATTTAA60
120
180
240
300
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_RS05855 [old locus tag: NWMN_1034 ]
- symbol: NWMN_RS05855
- description: hypothetical protein
- length: 99
- theoretical pI: 9.03807
- theoretical MW: 12082.8
- GRAVY: -0.765657
⊟Function[edit | edit source]
- TIGRFAM: DNA metabolism Other MutS2 family protein (TIGR01069; HMM-score: 8.3)
- TheSEED: see NWMN_1034
- PFAM: no clan defined DUF2951; Protein of unknown function (DUF2951) (PF11166; HMM-score: 181.6)and 9 moreXhlA; Haemolysin XhlA (PF10779; HMM-score: 18.5)MpPF26; M penetrans paralogue family 26 (PF07666; HMM-score: 17.1)TUNAR; TUNAR (PF21954; HMM-score: 15.6)Cyclin (CL0065) DUF3452; Domain of unknown function (DUF3452) (PF11934; HMM-score: 14.7)TPR (CL0020) Sec3_C_2; Sec3 exocyst complex subunit (PF15278; HMM-score: 14.7)no clan defined TelA; Toxic anion resistance protein (TelA) (PF05816; HMM-score: 14.2)YxiF; YxiF protein (PF24715; HMM-score: 13.7)DUF2207_C; Predicted membrane protein (DUF2207) C-terminal domain (PF20990; HMM-score: 12.5)PBDC1; PBDC1 protein (PF04669; HMM-score: 11.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 1.78
- Cytoplasmic Membrane Score: 8.16
- Cellwall Score: 0.06
- Extracellular Score: 0.01
- Internal Helix: 1
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0121
- Cytoplasmic Membrane Score: 0.8585
- Cell wall & surface Score: 0.0012
- Extracellular Score: 0.1282
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002263
- TAT(Tat/SPI): 0.001327
- LIPO(Sec/SPII): 0.000815
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MFGFTKRHEQDWRLTRLEENDKTMFEKFDRIEDSLRTQEKIYDKLDRNFEELRRDKVEDEKNKEKNAKNIRDIKMWILGLIGTIFSTIVIALLRTIFGI
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]