From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS04410 [old locus tag: NWMN_0779 ]
  • pan locus tag?: SAUPAN002836000
  • symbol: NWMN_RS04410
  • pan gene symbol?: trxQ
  • synonym:
  • product: thiol reductase thioredoxin

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_RS04410 [old locus tag: NWMN_0779 ]
  • symbol: NWMN_RS04410
  • product: thiol reductase thioredoxin
  • replicon: chromosome
  • strand: +
  • coordinates: 869364..869660
  • length: 297
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

  • Location: NC_009641 (869364..869660) NCBI
  • BioCyc:
  • MicrobesOnline: see NWMN_0779

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGAATAATTCATTAGACATCAAAGATGTAACTACATTTTATGAGGAAGACAAACATTTA
    ATCTTTGGTTATACACCAACGTGTGGTACTTGTAAGGTTTCAGAAAGAATGTTAGACATT
    GCTAATGAAATATTGCAGTTACCATTATTGAAAATAGATTTAAACTTTTATCCTCAGTTT
    TGTAAAGATATGCAAATCATGTCTACGCCGATTTTATTGTTGATGAATAAAGATAAAGAA
    GTAAAACGAATTTATGCATTTAAATCGGTGACTGATTTGTTAGAAAATTTAAAATAG
    60
    120
    180
    240
    297


⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: NWMN_RS04410 [old locus tag: NWMN_0779 ]
  • symbol: NWMN_RS04410
  • description: thiol reductase thioredoxin
  • length: 98
  • theoretical pI: 5.10475
  • theoretical MW: 11454.4
  • GRAVY: -0.118367

⊟Function[edit | edit source]

  • TIGRFAM:
    Metabolism Energy metabolism Electron transport thioredoxin (TIGR01068; HMM-score: 32.7)
    and 2 more
    Genetic information processing Protein fate Protein folding and stabilization protein disulfide-isomerase domain (TIGR01126; HMM-score: 18.6)
    putative alkyl hydroperoxide reductase F subunit (TIGR03143; EC 1.6.4.-; HMM-score: 14.9)
  • TheSEED: see NWMN_0779
  • PFAM:
    Thioredoxin (CL0172) Thioredoxin; Thioredoxin (PF00085; HMM-score: 34.9)
    and 4 more
    Thioredoxin_3; Thioredoxin domain (PF13192; HMM-score: 13.9)
    Glrx-like; Glutaredoxin-like domain (DUF836) (PF05768; HMM-score: 13.4)
    TraF; F plasmid transfer operon protein (PF13728; HMM-score: 13.4)
    Thioredoxin_2; Thioredoxin-like domain (PF13098; HMM-score: 13.3)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.8737
    • Cytoplasmic Membrane Score: 0.0792
    • Cell wall & surface Score: 0.0062
    • Extracellular Score: 0.0409
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.019301
    • TAT(Tat/SPI): 0.000557
    • LIPO(Sec/SPII): 0.004513
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MNNSLDIKDVTTFYEEDKHLIFGYTPTCGTCKVSERMLDIANEILQLPLLKIDLNFYPQFCKDMQIMSTPILLLMNKDKEVKRIYAFKSVTDLLENLK

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]


⊟Relevant publications[edit | edit source]