From AureoWiki
Jump to navigation Jump to search

NCBI: 06-JUL-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_2195 [new locus tag: NWMN_RS12665 ]
  • pan locus tag?: SAUPAN005760000
  • symbol: sarR
  • pan gene symbol?: sarR
  • synonym:
  • product: accessory regulator R

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_2195 [new locus tag: NWMN_RS12665 ]
  • symbol: sarR
  • product: accessory regulator R
  • replicon: chromosome
  • strand: -
  • coordinates: 2415214..2415561
  • length: 348
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGAGTAAAATTAATGACATTAATGATTTAGTCAACGCAACATTTCAAGTTAAGAAGTTT
    TTCAGAGATACAAAAAAGAAGTTCAATTTGAACTATGAAGAAATTTATATTTTAAATCAT
    ATTTTAAGAAGTGAGTCTAACGAAATCTCATCTAAAGAGATTGCTAAGTGCTCAGAGTTC
    AAACCTTACTATTTAACTAAAGCTTTACAAAAGCTAAAAGATTTAAAATTGTTATCAAAG
    AAAAGAAGTTTACAAGACGAAAGAACAGTTATTGTTTATGTTACAGATACACAAAAAGCA
    AATATTCAAAAACTGATTTCAGAATTAGAAGAATACATTAAAAATTAA
    60
    120
    180
    240
    300
    348

Protein[edit | edit source]

Protein Data Bank: 1HSJ

General[edit | edit source]

  • locus tag: NWMN_2195 [new locus tag: NWMN_RS12665 ]
  • symbol: SarR
  • description: accessory regulator R
  • length: 115
  • theoretical pI: 9.86544
  • theoretical MW: 13668.7
  • GRAVY: -0.623478

Function[edit | edit source]

  • TIGRFAM:
    Signal transduction Regulatory functions DNA interactions staphylococcal accessory regulator family (TIGR01889; HMM-score: 104.4)
    and 4 more
    homoprotocatechuate degradation operon regulator, HpaR (TIGR02337; HMM-score: 26.5)
    Signal transduction Regulatory functions DNA interactions CRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 15)
    mobile rSAM pair MarR family regulator (TIGR04472; HMM-score: 14.7)
    Metabolism Transport and binding proteins Unknown substrate efflux transporter, putative, hydrophobe/amphiphile efflux-3 (HAE3) family (TIGR00921; HMM-score: 11)
  • TheSEED: data available for COL, N315, NCTC8325, USA300_FPR3757
  • PFAM:
    HTH (CL0123) MarR_2; MarR family (PF12802; HMM-score: 30.5)
    and 7 more
    Rrf2; Transcriptional regulator (PF02082; HMM-score: 21.3)
    MarR; MarR family (PF01047; HMM-score: 19.1)
    TFIIE_alpha; TFIIE alpha subunit (PF02002; HMM-score: 17.4)
    PLP_aminotran (CL0061) Aminotran_5; Aminotransferase class-V (PF00266; HMM-score: 14.6)
    HTH (CL0123) HTH_27; Winged helix DNA-binding domain (PF13463; HMM-score: 14.2)
    no clan defined UDG; Uracil DNA glycosylase superfamily (PF03167; HMM-score: 13.2)
    HTH (CL0123) HrcA_DNA-bdg; Winged helix-turn-helix transcription repressor, HrcA DNA-binding (PF03444; HMM-score: 11.8)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 10
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.004625
    • TAT(Tat/SPI): 0.000187
    • LIPO(Sec/SPII): 0.000639
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MSKINDINDLVNATFQVKKFFRDTKKKFNLNYEEIYILNHILRSESNEISSKEIAKCSEFKPYYLTKALQKLKDLKLLSKKRSLQDERTVIVYVTDTQKANIQKLISELEEYIKN

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]