From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 06-JUL-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_2115 [new locus tag: NWMN_RS12235 ]
  • pan locus tag?: SAUPAN005646000
  • symbol: NWMN_2115
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_2115 [new locus tag: NWMN_RS12235 ]
  • symbol: NWMN_2115
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2353183..2354319
  • length: 1137
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    ATGGAAATTCATGTTTATACGGGACCGCTTTGTGGATTTAATGAATATATTAATTCTGAA
    GTTAAAGAATATCACCGCTTCATGGAATTAATCAGAGAATACAATATCATAGTGCGAGCA
    AGTGATACATTTGGAACTCATGATGTTGATGGTATTTTTGATACTGAGATAGAAAATCTT
    GTGATATTTTCAAACGACTTTGCTTCTGTAACAACTCATGTTATTACTAATTTTATAAAT
    ATCGTTACTTTAGGTAGAAATATTAAGAAAATCTATATTCAGAATCCTCCAAAAAGAGTA
    TTTCAATCACTAAATAGTTTTCACGATTCTGAAATAATAGAAATAAACTATGAATATACA
    ACATTAAAAAAAGATGATGTAATAAATTTTTATAAAGAGCAGATGGCTGGTTCTAAAATA
    ATAGGTCAAACAGACGCTAAAAAACAAATGAGCATAGATTTATATAAACATACTTCCTTA
    GAAAATAATAAACCGACCGTAATGCTTTACTATGGTCCATCAGGTGTTGGAAAAACAGAA
    TTAGCCAAAGAAATAGCAAAAAAATATAAAGGTAATATCACTAGAATACAATTTTCTATG
    ATGCAGAATGATGAATCTTTTAATTATATCTTTGGAGATGAACATGCCAAAGTATCATTG
    TCAAAAGATTTAGTAGATCGTGAAACTAATGTTGTTTTAATTGATGAATTTGATAAGGTA
    TTACCAATCTATTACAATGTTTTCTATCAAATGTTTGATGAAGGTATTATTGAAGATGCC
    AATTATAAAGTAGACGTTTCAAATTGTATTTTCATTCTAACATCTAATTTTAATAGTATT
    GAAGAAGCAATAGTTAATATTGGAGAACCGGTATTTTCTAGAATAGATTCCTGTATTAAA
    TTTTTATATTTAACACAGGAAGAAAAGCAGAAAGTAATAGAAAATAAATTAAATGAAATA
    CTATCATCTCTAAATGAAAAAGAAAAAAGAATAGTTACCGCATATAACTTGTTAGAGAAA
    TATAAAGAGACAGAAATAGATATCGATAACATTAGGTATTTAAAGAAAATAATAACAAAT
    GATATTTATACAATAATTTTTGAAGATGAATTATTTAATACGGATATTATAGATTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1137

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_2115 [new locus tag: NWMN_RS12235 ]
  • symbol: NWMN_2115
  • description: hypothetical protein
  • length: 378
  • theoretical pI: 4.58881
  • theoretical MW: 44099.8
  • GRAVY: -0.289947

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein fate Degradation of proteins, peptides, and glycopeptides ATP-dependent Clp protease ATP-binding subunit ClpA (TIGR02639; HMM-score: 67.3)
    Cellular processes Cellular processes Pathogenesis type VI secretion ATPase, ClpV1 family (TIGR03345; HMM-score: 61.1)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type VI secretion ATPase, ClpV1 family (TIGR03345; HMM-score: 61.1)
    Genetic information processing Protein fate Protein folding and stabilization ATP-dependent chaperone protein ClpB (TIGR03346; HMM-score: 57)
    and 12 more
    Genetic information processing DNA metabolism DNA replication, recombination, and repair Holliday junction DNA helicase RuvB (TIGR00635; EC 3.6.4.12; HMM-score: 33.1)
    Genetic information processing Protein fate Degradation of proteins, peptides, and glycopeptides endopeptidase La (TIGR00763; EC 3.4.21.53; HMM-score: 24.8)
    Genetic information processing Protein fate Protein folding and stabilization ATP-dependent protease HslVU, ATPase subunit (TIGR00390; HMM-score: 23.6)
    Cellular processes Cellular processes Other gas vesicle protein GvpN (TIGR02640; HMM-score: 19.1)
    26S proteasome subunit P45 family (TIGR01242; HMM-score: 18.3)
    AAA family ATPase, CDC48 subfamily (TIGR01243; HMM-score: 17.2)
    Genetic information processing DNA metabolism DNA replication, recombination, and repair orc1/cdc6 family replication initiation protein (TIGR02928; HMM-score: 15.6)
    Genetic information processing Protein fate Degradation of proteins, peptides, and glycopeptides proteasome ATPase (TIGR03689; EC 3.6.4.8; HMM-score: 15)
    Cellular processes Cellular processes Chemotaxis and motility flagellar biosynthesis protein FlhF (TIGR03499; HMM-score: 13.4)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking signal recognition particle-docking protein FtsY (TIGR00064; HMM-score: 12.8)
    phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 12.5)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type VII secretion AAA-ATPase EccA (TIGR03922; HMM-score: 11)
  • TheSEED  :
    • ClpB protein
    Protein Metabolism Protein degradation Proteolysis in bacteria, ATP-dependent  ClpB protein
    and 1 more
    Protein Metabolism Protein folding Protein chaperones  ClpB protein
  • PFAM:
    P-loop_NTPase (CL0023) AAA_2; AAA domain (Cdc48 subfamily) (PF07724; HMM-score: 66.4)
    and 26 more
    AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 43.9)
    AAA_5; AAA domain (dynein-related subfamily) (PF07728; HMM-score: 28.1)
    AAA_3; ATPase family associated with various cellular activities (AAA) (PF07726; HMM-score: 24.3)
    RuvB_N; Holliday junction DNA helicase RuvB P-loop domain (PF05496; HMM-score: 23.6)
    AAA_14; AAA domain (PF13173; HMM-score: 22)
    nSTAND3; Novel STAND NTPase 3 (PF20720; HMM-score: 20.2)
    RNA_helicase; RNA helicase (PF00910; HMM-score: 19.4)
    AAA_22; AAA domain (PF13401; HMM-score: 19.4)
    NB-ARC; NB-ARC domain (PF00931; HMM-score: 19)
    AAA_16; AAA ATPase domain (PF13191; HMM-score: 18.4)
    ATPase_2; ATPase domain predominantly from Archaea (PF01637; HMM-score: 16.2)
    Rad17; Rad17 P-loop domain (PF03215; HMM-score: 15.9)
    ABC_tran; ABC transporter (PF00005; HMM-score: 15.8)
    AAA_17; AAA domain (PF13207; HMM-score: 15.5)
    Bac_DnaA; Bacterial DnaA ATPAse domain (PF00308; HMM-score: 15.4)
    TsaE; Threonylcarbamoyl adenosine biosynthesis protein TsaE (PF02367; HMM-score: 15.3)
    AAA_18; AAA domain (PF13238; HMM-score: 15.3)
    AAA_7; P-loop containing dynein motor region (PF12775; HMM-score: 15.2)
    AAA_24; AAA domain (PF13479; HMM-score: 15)
    Zeta_toxin; Zeta toxin (PF06414; HMM-score: 14.4)
    NPHP3_N; Nephrocystin 3, N-terminal (PF24883; HMM-score: 13.6)
    RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 12.9)
    AAA_33; AAA domain (PF13671; HMM-score: 12.6)
    IstB_IS21; IstB-like ATP binding protein (PF01695; HMM-score: 12)
    NACHT; NACHT domain (PF05729; HMM-score: 11.9)
    AAA_25; AAA domain (PF13481; HMM-score: 11.1)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.572
    • Cytoplasmic Membrane Score: 0.1731
    • Cell wall & surface Score: 0.0016
    • Extracellular Score: 0.2532
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003073
    • TAT(Tat/SPI): 0.000098
    • LIPO(Sec/SPII): 0.000419
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MEIHVYTGPLCGFNEYINSEVKEYHRFMELIREYNIIVRASDTFGTHDVDGIFDTEIENLVIFSNDFASVTTHVITNFINIVTLGRNIKKIYIQNPPKRVFQSLNSFHDSEIIEINYEYTTLKKDDVINFYKEQMAGSKIIGQTDAKKQMSIDLYKHTSLENNKPTVMLYYGPSGVGKTELAKEIAKKYKGNITRIQFSMMQNDESFNYIFGDEHAKVSLSKDLVDRETNVVLIDEFDKVLPIYYNVFYQMFDEGIIEDANYKVDVSNCIFILTSNFNSIEEAIVNIGEPVFSRIDSCIKFLYLTQEEKQKVIENKLNEILSSLNEKEKRIVTAYNLLEKYKETEIDIDNIRYLKKIITNDIYTIIFEDELFNTDIID

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]