From AureoWiki
Jump to navigation Jump to search

NCBI: 06-JUL-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_2046 [new locus tag: NWMN_RS11815 ]
  • pan locus tag?: SAUPAN005439000
  • symbol: NWMN_2046
  • pan gene symbol?: —
  • synonym:
  • product: hypothetical protein

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_2046 [new locus tag: NWMN_RS11815 ]
  • symbol: NWMN_2046
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2264214..2264444
  • length: 231
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    TTGAAGCAATTTCTATATATTGCGTTAGTATGTGGTGTGATAGCAGGTCTTGGTGCTTTC
    TTACATATACCGCAGTATCCGAGCATGACAATTCCACGTATAGTAGCTATTTTAGGAATT
    ATCAGTGCTATGTTGACTTTTAAAGACAAGCAAATCAGCGCCTCATTAAAGTTTAGCGCA
    TTGTTAATTAATGTGCTGCCATTATGCGGTACCTTTGTAGCTTCAAATTAA
    60
    120
    180
    231


⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: NWMN_2046 [new locus tag: NWMN_RS11815 ]
  • symbol: NWMN_2046
  • description: hypothetical protein
  • length: 76
  • theoretical pI: 9.85612
  • theoretical MW: 8153.93
  • GRAVY: 1.11447

⊟Function[edit | edit source]

  • TIGRFAM:
    Cellular processes Cellular processes Chemotaxis and motility flagellar biosynthetic protein FliQ (TIGR01402; HMM-score: 13.9)
  • TheSEED  :
    • Hypothetical protein SAV2142
  • PFAM:
    Holin-V (CL0562) Phage_holin_5_2; Phage holin family Hol44, in holin superfamily V (PF16079; HMM-score: 12.5)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 3
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.0004
    • Cytoplasmic Membrane Score: 0.9962
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.0033
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.112464
    • TAT(Tat/SPI): 0.005356
    • LIPO(Sec/SPII): 0.103092
  • predicted transmembrane helices (TMHMM): 3

⊟Accession numbers[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MKQFLYIALVCGVIAGLGAFLHIPQYPSMTIPRIVAILGIISAMLTFKDKQISASLKFSALLINVLPLCGTFVASN

⊟Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]


⊟Relevant publications[edit | edit source]