From AureoWiki
Jump to navigation Jump to search

NCBI: 06-JUL-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_2005 [new locus tag: NWMN_RS11595 ]
  • pan locus tag?: SAUPAN005389000
  • symbol: NWMN_2005
  • pan gene symbol?: —
  • synonym:
  • product: hypothetical protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_2005 [new locus tag: NWMN_RS11595 ]
  • symbol: NWMN_2005
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2224303..2224536
  • length: 234
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGGATTATATCGGACAATATGCAGTTATCCATTTAGTGTTACATGTTGTATGTATTTGT
    ATTGCCTATTGGGCTTTACAATCAATTAGATTAGATCAATTTTTTAAAAAAGGATACGCC
    ACTCAATTACAAGTGTGTATGATATTTGTTGCTATTTTATTAGGCACTGCAGTAAGCAAT
    TTTATTGTAGATTTGTTACAATACTCGACGCAGGTAAAATATTTAATAAAATAA
    60
    120
    180
    234

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: NWMN_2005 [new locus tag: NWMN_RS11595 ]
  • symbol: NWMN_2005
  • description: hypothetical protein
  • length: 77
  • theoretical pI: 8.46673
  • theoretical MW: 8847.59
  • GRAVY: 0.911688

⊟Function[edit | edit source]

  • TIGRFAM:
    conserved hypothetical integral membrane protein (TIGR02327; HMM-score: 61.1)
  • TheSEED: data available for COL, N315, NCTC8325, USA300_FPR3757
  • PFAM:
    no clan defined DUF1146; Protein of unknown function (DUF1146) (PF06612; HMM-score: 72.3)
    and 1 more
    APC (CL0062) CstA; Carbon starvation protein CstA (PF02554; HMM-score: 13.7)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 2
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003159
    • TAT(Tat/SPI): 0.000129
    • LIPO(Sec/SPII): 0.03256
  • predicted transmembrane helices (TMHMM): 2

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MDYIGQYAVIHLVLHVVCICIAYWALQSIRLDQFFKKGYATQLQVCMIFVAILLGTAVSNFIVDLLQYSTQVKYLIK

⊟Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator: SigB (activation) regulon
    SigB(sigma factor)controlling a large regulon involved in stress/starvation response and adaptation;  [1] [2]   other strains

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
    Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
    J Bacteriol: 2004, 186(13);4085-99
    [PubMed:15205410] [WorldCat.org] [DOI] (P p)
  2. ↑ Bettina Schulthess, Dominik A Bloes, Patrice François, Myriam Girard, Jacques Schrenzel, Markus Bischoff, Brigitte Berger-Bächi
    The σB-dependent yabJ-spoVG operon is involved in the regulation of extracellular nuclease, lipase, and protease expression in Staphylococcus aureus.
    J Bacteriol: 2011, 193(18);4954-62
    [PubMed:21725011] [WorldCat.org] [DOI] (I p)

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=NWMN_2005&oldid=69458"