Jump to navigation
Jump to search
NCBI: 06-JUL-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_1874 [new locus tag: NWMN_RS15460 ]
- pan locus tag?: SAUPAN005015000
- symbol: NWMN_1874
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_1874 [new locus tag: NWMN_RS15460 ]
- symbol: NWMN_1874
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 2088833..2089141
- length: 309
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 5331142 NCBI
- RefSeq: YP_001332908 NCBI
- BioCyc:
- MicrobesOnline: 3707462 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301GTGAAGAACCATACAAATATAATTAATATCTTATTAGTTATAGTCAACTCATTAACTCAT
TTTCTAACTCTAAACACCTCATTTTTTAATAATTCAGCATCGGATTTCTGTTTTATCATA
GGGGCTATATTTTTCTTAATCGGAATTTTTGTTGCAATATACGGTATGAAGCGAGCAACA
TATTGGTTAAACTTATTGATTTTATTTACCAATATTTTTTATTTTCTACACTTCTGTGTG
TTACTTTTGTTAAAATATATAGGATTTAAATTATTTATTTATGAAGGGTGTGTATTGTTA
TTTACCTAA60
120
180
240
300
309
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_1874 [new locus tag: NWMN_RS15460 ]
- symbol: NWMN_1874
- description: hypothetical protein
- length: 102
- theoretical pI: 8.84585
- theoretical MW: 11893.3
- GRAVY: 1.24706
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- Phage protein
- PFAM: CopD_like (CL0430) YtpI; YtpI-like protein (PF14007; HMM-score: 18.9)no clan defined DUF202; Domain of unknown function (DUF202) (PF02656; HMM-score: 17.1)and 2 moreTSPAN_4TM-like (CL0347) Tetraspanin; Tetraspanin family (PF00335; HMM-score: 8.1)no clan defined CRPA; Chlamydia 15 kDa cysteine-rich outer membrane protein (CRPA) (PF05745; HMM-score: 7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 3
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0006
- Cytoplasmic Membrane Score: 0.98
- Cell wall & surface Score: 0
- Extracellular Score: 0.0194
- LocateP: Multi-transmembrane
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.016462
- TAT(Tat/SPI): 0.000279
- LIPO(Sec/SPII): 0.051813
- predicted transmembrane helices (TMHMM): 3
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKNHTNIINILLVIVNSLTHFLTLNTSFFNNSASDFCFIIGAIFFLIGIFVAIYGMKRATYWLNLLILFTNIFYFLHFCVLLLLKYIGFKLFIYEGCVLLFT
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.