From AureoWiki
Jump to navigation Jump to search

NCBI: 06-JUL-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_1527 [new locus tag: NWMN_RS08575 ]
  • pan locus tag?: SAUPAN004227000
  • symbol: NWMN_1527
  • pan gene symbol?: csbD
  • synonym:
  • product: hypothetical protein

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_1527 [new locus tag: NWMN_RS08575 ]
  • symbol: NWMN_1527
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1692649..1692831
  • length: 183
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGGCAGACGAAAGTAAGTTCGATCAATTTAAAGGAAATGTTAAAGAAACAGTAGGTAAC
    GTTACTGATAACAAAGAATTAGAAAAAGAAGGTCAGCAAGATAAAGTGATTGGTAAAGCA
    AAAGAAGTTGTTGAAAATGCTAAAAACAAAATAACTGATGCAATTGATAAACTTAAAAAA
    TAA
    60
    120
    180
    183


⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: NWMN_1527 [new locus tag: NWMN_RS08575 ]
  • symbol: NWMN_1527
  • description: hypothetical protein
  • length: 60
  • theoretical pI: 6.85884
  • theoretical MW: 6722.53
  • GRAVY: -1.12833

⊟Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • sigmaB-controlled gene product
  • PFAM:
    YjbJ-CsbD-like (CL0406) CsbD; CsbD-like (PF05532; HMM-score: 57)
    and 4 more
    Spectrin (CL0743) TBCA; Tubulin binding cofactor A (PF02970; HMM-score: 16.9)
    no clan defined Etd1; Septation protein etd1 (PF20162; HMM-score: 14.1)
    YtxH; YtxH-like protein (PF12732; HMM-score: 11.9)
    DUF6353; Family of unknown function (DUF6353) (PF19880; HMM-score: 11)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Extracellular
    • Cytoplasmic Score: 0.24
    • Cytoplasmic Membrane Score: 0.05
    • Cellwall Score: 0.8
    • Extracellular Score: 8.91
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.4352
    • Cytoplasmic Membrane Score: 0.01
    • Cell wall & surface Score: 0.1632
    • Extracellular Score: 0.3915
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.010269
    • TAT(Tat/SPI): 0.002049
    • LIPO(Sec/SPII): 0.003958
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MADESKFDQFKGNVKETVGNVTDNKELEKEGQQDKVIGKAKEVVENAKNKITDAIDKLKK

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator: SigB (activation) regulon
    SigB(sigma factor)controlling a large regulon involved in stress/starvation response and adaptation;  [1]   other strains

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
    Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
    J Bacteriol: 2004, 186(13);4085-99
    [PubMed:15205410] [WorldCat.org] [DOI] (P p)

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=NWMN_1527&oldid=120857"