Jump to navigation
Jump to search
NCBI: 06-JUL-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_1253 [new locus tag: NWMN_RS07075 ]
- pan locus tag?: SAUPAN003716000
- symbol: NWMN_1253
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_1253 [new locus tag: NWMN_RS07075 ]
- symbol: NWMN_1253
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 1376149..1376388
- length: 240
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 5330746 NCBI
- RefSeq: YP_001332287 NCBI
- BioCyc:
- MicrobesOnline: 3706805 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181TTGAGTAATTCTGATTTGAATATCGAAAGAATTAACGAGTTAGCTAAAAAGAAAAAAGAA
GTAGGATTAACTCAAGAAGAAGCAAAGGAGCAAACAGCCTTAAGAAAAGCTTATCTTGAG
AGTTTTAGAAAAGGGTTTAAACAACAAATTGAAAATACTAAAGTAATTGATCCAGAAGGT
AATGATGTAACACCTGAAAAAATTAAAGAGATACAACAAAAAAGAGATAATAAAAATTAA60
120
180
240
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_1253 [new locus tag: NWMN_RS07075 ]
- symbol: NWMN_1253
- description: hypothetical protein
- length: 79
- theoretical pI: 9.63152
- theoretical MW: 9203.33
- GRAVY: -1.32025
⊟Function[edit | edit source]
- TIGRFAM: DNA metabolism DNA replication, recombination, and repair DNA (cytosine-5-)-methyltransferase (TIGR00675; EC 2.1.1.37; HMM-score: 14.4)
- TheSEED: data available for COL, N315, NCTC8325, USA300_FPR3757
- PFAM: no clan defined DUF896; Bacterial protein of unknown function (DUF896) (PF05979; HMM-score: 109.1)and 2 moreDUF3653; Phage protein (PF12375; HMM-score: 12.8)DUF5322; Family of unknown function (DUF5322) (PF17255; HMM-score: 11.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.004735
- TAT(Tat/SPI): 0.000565
- LIPO(Sec/SPII): 0.000817
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSNSDLNIERINELAKKKKEVGLTQEEAKEQTALRKAYLESFRKGFKQQIENTKVIDPEGNDVTPEKIKEIQQKRDNKN
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.