Jump to navigation
		Jump to search
		
NCBI: 06-JUL-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_0955 [new locus tag: NWMN_RS05350 ]
- pan locus tag?: SAUPAN003310000
- symbol: NWMN_0955
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_0955 [new locus tag: NWMN_RS05350 ]
- symbol: NWMN_0955
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 1060677..1060832
- length: 156
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 5330571 NCBI
- RefSeq: YP_001331989 NCBI
- BioCyc:
- MicrobesOnline: 3706506 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
 61
 121ATGATATTTTCTCAAAATTTATTTCGTCGTCCCACCCCAACTTACATTGTCTGTAGAAAT
 TGGGAATCCAATTTCTCTTTGTTGGGGCCCACACCCCAACTCGCATTGCCTGTAGAATTT
 CTTTTCGAAATTCTCTATGTTGGGGCCCCTGACTAG60
 120
 156
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_0955 [new locus tag: NWMN_RS05350 ]
- symbol: NWMN_0955
- description: hypothetical protein
- length: 51
- theoretical pI: 4.58752
- theoretical MW: 5902.83
- GRAVY: 0.221569
⊟Function[edit | edit source]
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helices: 0
 
- DeepLocPro: Cytoplasmic- Cytoplasmic Score: 0.6193
- Cytoplasmic Membrane Score: 0.1197
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.2609
 
- LocateP: Intracellular - Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
 
- SignalP: no predicted signal peptide- SP(Sec/SPI): 0.017918
- TAT(Tat/SPI): 0.001788
- LIPO(Sec/SPII): 0.009382
 
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MIFSQNLFRRPTPTYIVCRNWESNFSLLGPTPQLALPVEFLFEILYVGAPD
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]