Jump to navigation
Jump to search
NCBI: 06-JUL-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_0472 [new locus tag: NWMN_RS02700 ]
- pan locus tag?: SAUPAN002251000
- symbol: hpt
- pan gene symbol?: hprT
- synonym:
- product: hypoxanthine phosphoribosyltransferase
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_0472 [new locus tag: NWMN_RS02700 ]
- symbol: hpt
- product: hypoxanthine phosphoribosyltransferase
- replicon: chromosome
- strand: +
- coordinates: 536565..537080
- length: 516
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 5332545 NCBI
- RefSeq: YP_001331506 NCBI
- BioCyc:
- MicrobesOnline: 3706006 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481TTGTTAACTGAAGAAGATATTCAAAATATCTGTAAGGAATTGGGAGCACAATTAACAAAG
GATTATCAAGGTAAACCATTAGTATGCGTGGGTATCTTAAAAGGCTCAGCAATGTTTATG
TCAGATTTAATTAAACGAATTGATACCCATTTATCAATTGATTTCATGGATGTTTCTAGT
TATCACGGAGGCACTGAGTCAACTGGTGAAGTTCAAATCATTAAAGATTTAGGTTCTTCT
ATTGAAAATAAAGACGTATTAATTATTGAAGATATCTTAGAGACTGGTACTACACTTAAG
TCAATTACTGAATTATTACAATCTAGAAAAGTTAATTCATTAGAAATAGTTACTTTATTA
GATAAACCAAACCGTCGTAAAGCGGACATTGAAGCTAAGTATGTAGGTAAAAAAATACCA
GATGAATTTGTTGTTGGTTACGGTTTAGATTATCGTGAATTATACCGAAACTTACCATAT
ATCGGTACGTTAAAACCTGAAGTGTATTCAAATTAA60
120
180
240
300
360
420
480
516
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_0472 [new locus tag: NWMN_RS02700 ]
- symbol: Hpt
- description: hypoxanthine phosphoribosyltransferase
- length: 171
- theoretical pI: 4.77462
- theoretical MW: 19205
- GRAVY: -0.227485
⊟Function[edit | edit source]
- reaction: EC 2.4.2.8? ExPASyHypoxanthine phosphoribosyltransferase IMP + diphosphate = hypoxanthine + 5-phospho-alpha-D-ribose 1-diphosphate
- TIGRFAM: Purines, pyrimidines, nucleosides, and nucleotides Salvage of nucleosides and nucleotides hypoxanthine phosphoribosyltransferase (TIGR01203; EC 2.4.2.8; HMM-score: 214.4)and 10 morePurines, pyrimidines, nucleosides, and nucleotides Salvage of nucleosides and nucleotides uracil phosphoribosyltransferase (TIGR01091; EC 2.4.2.9; HMM-score: 22.9)Purines, pyrimidines, nucleosides, and nucleotides Pyrimidine ribonucleotide biosynthesis orotate phosphoribosyltransferase (TIGR00336; EC 2.4.2.10; HMM-score: 21.9)Purines, pyrimidines, nucleosides, and nucleotides Purine ribonucleotide biosynthesis ribose-phosphate diphosphokinase (TIGR01251; EC 2.7.6.1; HMM-score: 20)Cellular processes DNA transformation comF family protein (TIGR00201; HMM-score: 19.3)Purines, pyrimidines, nucleosides, and nucleotides Salvage of nucleosides and nucleotides adenine phosphoribosyltransferase (TIGR01090; EC 2.4.2.7; HMM-score: 19.1)Purines, pyrimidines, nucleosides, and nucleotides Purine ribonucleotide biosynthesis pur operon repressor PurR (TIGR01743; HMM-score: 14.1)Regulatory functions DNA interactions pur operon repressor PurR (TIGR01743; HMM-score: 14.1)Purines, pyrimidines, nucleosides, and nucleotides Pyrimidine ribonucleotide biosynthesis orotate phosphoribosyltransferase (TIGR01367; EC 2.4.2.10; HMM-score: 13.4)Purines, pyrimidines, nucleosides, and nucleotides Salvage of nucleosides and nucleotides xanthine phosphoribosyltransferase (TIGR01744; EC 2.4.2.22; HMM-score: 12.6)Transcription RNA processing queuine synthase (TIGR03138; EC 1.7.1.13; HMM-score: 12.5)
- TheSEED :
- Hypoxanthine-guanine phosphoribosyltransferase (EC 2.4.2.8)
- PFAM: PRTase-like (CL0533) Pribosyltran; Phosphoribosyl transferase domain (PF00156; HMM-score: 104.8)and 3 moreUPRTase; Uracil phosphoribosyltransferase (PF14681; HMM-score: 18.7)P-loop_NTPase (CL0023) Helicase_C; Helicase conserved C-terminal domain (PF00271; HMM-score: 15.5)PRTase-like (CL0533) PRTase_2; Phosphoribosyl transferase (PF15609; HMM-score: 12.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors: Mg2+
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9919
- Cytoplasmic Membrane Score: 0.0001
- Cell wall & surface Score: 0
- Extracellular Score: 0.0079
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.005531
- TAT(Tat/SPI): 0.000312
- LIPO(Sec/SPII): 0.000706
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MLTEEDIQNICKELGAQLTKDYQGKPLVCVGILKGSAMFMSDLIKRIDTHLSIDFMDVSSYHGGTESTGEVQIIKDLGSSIENKDVLIIEDILETGTTLKSITELLQSRKVNSLEIVTLLDKPNRRKADIEAKYVGKKIPDEFVVGYGLDYRELYRNLPYIGTLKPEVYSN
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.0 1.1 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)