From AureoWiki
Jump to navigation Jump to search

NCBI: 06-JUL-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_0457 [new locus tag: NWMN_RS02610 ]
  • pan locus tag?: SAUPAN002232000
  • symbol: veg
  • pan gene symbol?: veg
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_0457 [new locus tag: NWMN_RS02610 ]
  • symbol: veg
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 520146..520409
  • length: 264
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGCCAAAATCAATTTTGGACATCAAAAATTCTATTGATTGTCATGTAGGAAATCGTATT
    GTACTGAAAGCCAATGGAGGCCGTAAGAAAACAATAAAACGTTCTGGAATTTTAAAAGAA
    ACATATCCGTCAGTTTTCATTGTTGAGTTAGATCAAGACAAACACAACTTTGAGAGAGTA
    TCTTATACATACACTGATGTGTTAACTGAAAATGTTCAAGTTTCATTTGAAGAGGATAAT
    CATCACGAATCAATTGCACACTAA
    60
    120
    180
    240
    264

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_0457 [new locus tag: NWMN_RS02610 ]
  • symbol: Veg
  • description: hypothetical protein
  • length: 87
  • theoretical pI: 7.07163
  • theoretical MW: 9998.21
  • GRAVY: -0.591954

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • Veg protein
  • PFAM:
    SH3 (CL0010) VEG; Biofilm formation stimulator VEG (PF06257; HMM-score: 108.8)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9907
    • Cytoplasmic Membrane Score: 0.0016
    • Cell wall & surface Score: 0.0008
    • Extracellular Score: 0.007
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003095
    • TAT(Tat/SPI): 0.00022
    • LIPO(Sec/SPII): 0.000554
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MPKSILDIKNSIDCHVGNRIVLKANGGRKKTIKRSGILKETYPSVFIVELDQDKHNFERVSYTYTDVLTENVQVSFEEDNHHESIAH

Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]