From AureoWiki
Jump to navigation Jump to search

NCBI: 06-JUL-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_0447 [new locus tag: NWMN_RS02545 ]
  • pan locus tag?: SAUPAN002217000
  • symbol: NWMN_0447
  • pan gene symbol?: darA
  • synonym: pstA
  • product: hypothetical protein

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_0447 [new locus tag: NWMN_RS02545 ]
  • symbol: NWMN_0447
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 510659..510988
  • length: 330
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGAAAATGATTATAGCGATCGTACAAGATCAAGATAGTCAGGAACTTGCAGATCAACTT
    GTTAAAAATAACTTTAGAGCAACAAAATTGGCAACAACAGGTGGGTTTTTAAGAGCGGGT
    AATACAACATTCTTATGTGGTGTCAATGATGACCGTGTAGATGAAATATTGTCTGTGATT
    AATCAAACGTGTGGTAATAGAGAACAGTTGGTTTCACCTATTACACCTATGGGAGGCAGT
    GCGGATTCGTACATTCCATATCCAGTTGAAGTTGAAGTTGGCGGTGCTACTGTATTTGTT
    ATGCCAGTTGATGCATTCCATCAATTTTAA
    60
    120
    180
    240
    300
    330


⊟Protein[edit | edit source]

Protein Data Bank: 4WK1
Protein Data Bank: 4WK3
Protein Data Bank: 4D3G
Protein Data Bank: 4D3H

⊟General[edit | edit source]

  • locus tag: NWMN_0447 [new locus tag: NWMN_RS02545 ]
  • symbol: NWMN_0447
  • description: hypothetical protein
  • length: 109
  • theoretical pI: 4.21092
  • theoretical MW: 11838.4
  • GRAVY: 0.0422018

⊟Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • Cyclic di-AMP receptor A
    CBSS-393133.3.peg.2787  protein from nitrogen regulatory protein P-II (GLNB) family, ortholog YAAQ B. subtilis
  • PFAM:
    GlnB-like (CL0089) CdAMP_rec; Cyclic-di-AMP receptor (PF06153; HMM-score: 183.4)
    and 1 more
    P-II; Nitrogen regulatory protein P-II (PF00543; HMM-score: 16.4)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9792
    • Cytoplasmic Membrane Score: 0.0095
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.0112
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.047234
    • TAT(Tat/SPI): 0.008151
    • LIPO(Sec/SPII): 0.00179
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MKMIIAIVQDQDSQELADQLVKNNFRATKLATTGGFLRAGNTTFLCGVNDDRVDEILSVINQTCGNREQLVSPITPMGGSADSYIPYPVEVEVGGATVFVMPVDAFHQF

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]


⊟Relevant publications[edit | edit source]

Rebecca M Corrigan, Ivan Campeotto, Tharshika Jeganathan, Kevin G Roelofs, Vincent T Lee, Angelika Gründling
Systematic identification of conserved bacterial c-di-AMP receptor proteins.
Proc Natl Acad Sci U S A: 2013, 110(22);9084-9
[PubMed:23671116] [WorldCat.org] [DOI] (I p)