Jump to navigation
		Jump to search
		
NCBI: 06-JUL-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_0174 [new locus tag: NWMN_RS00960 ]
- pan locus tag?: SAUPAN001103000
- symbol: NWMN_0174
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_0174 [new locus tag: NWMN_RS00960 ]
- symbol: NWMN_0174
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 225884..226240
- length: 357
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 5330029 NCBI
- RefSeq: YP_001331209 NCBI
- BioCyc:
- MicrobesOnline: 3705705 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
 61
 121
 181
 241
 301ATGACCGTAGATATTGGACGGATTTATGACAATAAAGATAATACCGACGCTATTCGTATC
 CTAGTCGATAGAGTCTGGCCGAGAGGTATTTCGAAAAGAACTGCTAACCTAGATTATTGG
 TTAAAAGACATTGCCCCTTCTACTGAGTTGCGACAATGGTTCCAACATGATCCTAAACTT
 TTTGGAGCTTTTAAAGAAAAATATGAAAAAGAATTACGTGATCAGGATGCGCAAAAAGAT
 GCTTTTGAAAAATTAAAGGATATTGTAAATCAGCATAATCATGTTCTATTGTTATATGCA
 GCAAAAGATACTAAACATAACCAAGCTGTAGTACTACAGCAGTTGCTCAATACTTAG60
 120
 180
 240
 300
 357
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_0174 [new locus tag: NWMN_RS00960 ]
- symbol: NWMN_0174
- description: hypothetical protein
- length: 118
- theoretical pI: 8.87228
- theoretical MW: 13934.7
- GRAVY: -0.734746
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED  : - DUF488 family protein SAV0238
 
- PFAM: Phosphatase (CL0031) DUF488-N3i; Inactive DUF488-N3 subclade (PF22752; HMM-score: 120.4)DUF488; Domain of unknown function DUF488 (PF04343; HMM-score: 112.5)and 2 moreDUF488-N3a; Active DUF488-N3 subclade (PF22751; HMM-score: 85.8)no clan defined Inhibitor_I29; Cathepsin propeptide inhibitor domain (I29) (PF08246; HMM-score: 14.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
 
- DeepLocPro: Cytoplasmic- Cytoplasmic Score: 0.995
- Cytoplasmic Membrane Score: 0.0003
- Cell wall & surface Score: 0.0003
- Extracellular Score: 0.0044
 
- LocateP: Intracellular - Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
 
- SignalP: no predicted signal peptide- SP(Sec/SPI): 0.002823
- TAT(Tat/SPI): 0.000174
- LIPO(Sec/SPII): 0.000548
 
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MTVDIGRIYDNKDNTDAIRILVDRVWPRGISKRTANLDYWLKDIAPSTELRQWFQHDPKLFGAFKEKYEKELRDQDAQKDAFEKLKDIVNQHNHVLLLYAAKDTKHNQAVVLQQLLNT
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]