Jump to navigation
Jump to search
FunGene: 08-OCT-2024
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: JSNZ_002338
- pan locus tag?: SAUPAN005885000
- symbol: JSNZ_002338
- pan gene symbol?: paiA
- synonym:
- product: N-acetyltransferase
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: JSNZ_002338
- symbol: JSNZ_002338
- product: N-acetyltransferase
- replicon: chromosome
- strand: -
- coordinates: 2336969..2337484
- length: 516
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq:
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481ATGGCTGGGATAATCAAAGAAATTTCAGAACAAAATGCTAGTGAATTAGTTGAATTAGCA
ACTAGAACATTTTATGACACGTTTGGTTCTTACTATGATGACAAAGATTTTGATCAATTT
TTTAAAGACAATTATACTGTAGAAAAATTTACACAAGAGATTAACCATGTAGATTCATTT
CATTATTTTTATCAAGAAGATGGTGCGAATGTTGGTTATATAAAAATGAATATTAATAGT
GCTCAAACTGAAGAAATGGGGGAGACCTATTTAGAAGTGCAGCGCATATATTTTTTGAAA
GACTTTCAAGGTGGCGGAAGAGGTTCACAATTGATAGAATTGGCCGAAAAAATTGCACAA
GAACATAATAAACATAAAATTTGGCTAGGAGTTTGGGAGCATAATCCTCGTGCTCAAGCA
TTTTATAAACGTCATGGATTTAAAGTGGTTGGTGAACATCATTTTCAAACAGGTGATGTA
ACGGATACAGATTTAATTATGGAAAAAGAGTTATAA60
120
180
240
300
360
420
480
516
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: JSNZ_002338
- symbol: JSNZ_002338
- description: N-acetyltransferase
- length: 171
- theoretical pI: 4.71992
- theoretical MW: 20071.1
- GRAVY: -0.690643
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Ribosomal proteins: synthesis and modification ribosomal-protein-alanine acetyltransferase (TIGR01575; EC 2.3.1.128; HMM-score: 49.4)and 2 moreUDP-4-amino-4,6-dideoxy-N-acetyl-beta-L-altrosamine N-acetyltransferase (TIGR03585; EC 2.3.1.202; HMM-score: 27.9)Biosynthesis of cofactors, prosthetic groups, and carriers Glutathione and analogs mycothiol synthase (TIGR03448; EC 2.3.1.189; HMM-score: 18.1)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: Acetyltrans (CL0257) Acetyltransf_1; Acetyltransferase (GNAT) family (PF00583; HMM-score: 67.2)and 8 moreAcetyltransf_7; Acetyltransferase (GNAT) domain (PF13508; HMM-score: 51.4)Acetyltransf_10; Acetyltransferase (GNAT) domain (PF13673; HMM-score: 49.7)Acetyltransf_4; Acetyltransferase (GNAT) domain (PF13420; HMM-score: 28.4)Acetyltransf_3; Acetyltransferase (GNAT) domain (PF13302; HMM-score: 25.5)FR47; FR47-like protein (PF08445; HMM-score: 24.3)FeeM; N-acyl amino acid synthase FeeM (PF21926; HMM-score: 18.6)no clan defined NKWYS; Putative capsular polysaccharide synthesis protein (PF10364; HMM-score: 16.1)Acetyltrans (CL0257) Acetyltransf_18; Acetyltransferase (GNAT) domain (PF18014; HMM-score: 12.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9998
- Cytoplasmic Membrane Score: 0
- Cell wall & surface Score: 0
- Extracellular Score: 0.0002
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.003821
- TAT(Tat/SPI): 0.000299
- LIPO(Sec/SPII): 0.001179
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq:
- UniProt:
⊟Protein sequence[edit | edit source]
- MAGIIKEISEQNASELVELATRTFYDTFGSYYDDKDFDQFFKDNYTVEKFTQEINHVDSFHYFYQEDGANVGYIKMNINSAQTEEMGETYLEVQRIYFLKDFQGGGRGSQLIELAEKIAQEHNKHKIWLGVWEHNPRAQAFYKRHGFKVVGEHHFQTGDVTDTDLIMEKEL
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]