Jump to navigation
Jump to search
FunGene: 08-OCT-2024
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: JSNZ_001988
- pan locus tag?: SAUPAN005274000
- symbol: JSNZ_001988
- pan gene symbol?: hld
- synonym:
- product: delta-lysin family phenol-soluble modulin
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: JSNZ_001988
- symbol: JSNZ_001988
- product: delta-lysin family phenol-soluble modulin
- replicon: chromosome
- strand: -
- coordinates: 2003273..2003407
- length: 135
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq:
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121ATGAGTTGTTTAATTTTAAGAATTTTTATCTTAATTAAGGAAGGAGTGATTTCAATGGCA
CAAGATATCATTTCAACAATCGGTGACTTAGTAAAATGGATTATCGACACAGTGAACAAA
TTCACTAAAAAATAA60
120
135
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: JSNZ_001988
- symbol: JSNZ_001988
- description: delta-lysin family phenol-soluble modulin
- length: 44
- theoretical pI: 9.46068
- theoretical MW: 5009.12
- GRAVY: 0.802273
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: data available for COL, N315, NCTC8325, USA300_FPR3757
- PFAM: no clan defined Delta_lysin; Delta lysin family (PF05372; HMM-score: 71.9)and 1 morePSMdelta; Phenol-soluble modulin delta protein (PF19693; HMM-score: 19.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0.0025
- Cytoplasmic Membrane Score: 0.0371
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.9602
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.098909
- TAT(Tat/SPI): 0.001539
- LIPO(Sec/SPII): 0.021637
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq:
- UniProt:
⊟Protein sequence[edit | edit source]
- MSCLILRIFILIKEGVISMAQDIISTIGDLVKWIIDTVNKFTKK
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: AgrA (activation) regulon
AgrA (TF) important in Virulence, Quorum sensing; regulation predicted or transferred from N315 and NCTC 8325 in Wolfgramm et al. (https://doi.org/10.1101/2025.09.03.674026)
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.